Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0274 IGR0280 IGR0276 IGR0273 IGR0278 IGR0275 IGR0281 IGR0279 IGR0277 NG0337 NG0330 NG0336 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0331 bcp, - NG0328 NG0339 dapF, - NG0338 xerD, - NG0329 purC, - NG0333 pnp, - NG0335 NG0337 NG0330 NG0336 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0331 bcp, - NG0328 NG0339 dapF, - NG0338 xerD, - NG0329 purC, - NG0333 pnp, - NG0335 NG0330 NG0336 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0337 NG0331 bcp, - NG0328 dapF, - NG0338 xerD, - NG0329 purC, - NG0333 pnp, - NG0335 NG0339
* Calculated from Protein Sequence

Gene ID: NG0333

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
purC  

Definition:
phosphoribosylaminoimidazole-succinocarboxamide synthase (saicar synthase)

Gene Start:
328606

Gene Stop:
329562

Gene Length:
957

Molecular Weight*:
35954

pI*:
5.50

Net Charge*:
-4.48

EC:
6.3.2.6  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Meyer E, Leonard NJ, Bhat B, Stubbe J, Smith JM.
Purification and characterization of the purE, purK, and purC gene products: identification of a previously unrecognized energy requirement in the purine biosynthetic pathway.
Biochemistry. 1992 Jun 2;31(21):5022-32.
PMID: 1534690

Comment:
Oklahoma ID: NGO.333

For other 'pur' genes, see NG0263 (purF), NG0398 (purA), NG0526 (purM), NG0748 (purE), NG0875 (purK), NG1183 (purL), NG1224 (purN), NG1466 (purH), NG1711 (purB), NG1939 (purD)

Blast Summary:  PSI-Blast Search
NG0333 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative phosphoribosylaminoimidazole-succinocarboxamide synthase protein: residues 1-287 are 96% similar to residues 33-319 of NG0333.

Numerous significant hits to phosphoribosylaminoimidazole-succinocarboxamide synthase (saicar synthase) in gapped BLAST; e.g. residues 33-318 are 75% similar to phosphoribosylaminoimidazole-succinocarboxamide synthase (saicar synthase) of Pasteurella multocida, residues 36-318 are 74% similar to gb|AAC23372.1| phosphoribosylaminoimidazole-succinocarboxamide synthase of Haemophilus influenzae Rd, residues 37-316 are 59% similar to gb|AAF83018.1|AE003874_2 phosphoribosylaminoimidazole-succinocarboxamide synthase of Xylella fastidiosa.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0152
COG name: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
Functional Class:  F
The phylogenetic pattern of COG0152 is amtkyqvcebrh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001636 (SAICAR synthetase) with a combined E-value of 9.6e-80.
    IPB001636A    41-54
    IPB001636B    62-92
    IPB001636C    125-145
    IPB001636D    164-188
    IPB001636E    227-240
    IPB001636F    246-261
    IPB001636G    274-283


ProDom Summary:  Protein Domain Search
Residues 36-301 are 74% similar to a (SYNTHASE SAICAR SYNTHETASE PURINE BIOSYNTHESIS LIGASE) protein domain (PD003043) which is seen in PUR7_HAEIN.



Paralogs:  Local Blast Search


NG0333 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 37 to 301 (E-value = 2.4e-150) place NG0333 in the SAICAR_synt family which is described as SAICAR synthetase (PF01259)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1A48|1A48 SAICAR SYNTHASE 273.0 2e-74
pdb|1KUT|1KUT-A STRUCTURAL GENOMICS, PROTEIN TM1243, (SAICAR 49.2 1e-06
pdb|1A48|1A48 SAICAR SYNTHASE 427.0 0e+00
pdb|1KUT|1KUT-A STRU

Gene Protein Sequence:
MGIVLRRLRLEYRFAIQTCRVGIFKIFSGGCEMSEIGLVKIYSGKVRDLY
EIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHIMPN
HFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDY
QKTGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVGDHDENISFEECGRII
GKELAEEVRDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDE
VLTPDSSRFWPADQYEVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPAD
VIRKTVEKYQEALTLLTQD

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTATTGTTTTGCGCCGACTTCGGCTAGAATATCGGTTTGCGATTCA
AACCTGTCGGGTCGGTATTTTCAAGATATTTTCAGGGGGGTGCGAAATGA
GTGAGATTGGTTTGGTAAAGATTTATTCCGGAAAAGTGCGCGATTTATAT
GAAATCGACGATAAACGTATGCTGATGGTCGCTTCCGACCGCCTGTCCGC
GTTTGATGTGATTTTGGACGCCCCGATTCCGGGTAAGGGCGAAATCCTGA
CGCAGATTTCCAATTTTTGGTTTAAAAAACTGGCGCATATTATGCCCAAC
CATTTCACCGGCGATACCGTGTACGATGTTTTGCCTGAAAACGAAGCCAA
AGCTTTGGAAAAACGCGCCGTTGTAGCTAAAAAACTCACTCCGGTGAAAG
TGGAGGCCATTGTGCGCGGTTATCTGGCAGGCAGCGGTTGGAAAGATTAT
CAAAAAACCGGCTCGGTTTGCGGTATTCGGCTGCCCGAAGGTATGCGGGA
AGCGCAACAACTACCCGAAGTGATTTTTACGCCCTCAACTAAAGCCGCAG
TCGGCGATCACGATGAAAACATCAGCTTTGAAGAATGCGGACGCATTATC
GGTAAAGAATTGGCGGAAGAAGTGCGCGACAAAGCGGTTCGGCTTTACAC
CGAAGCGGCGGAATATGCCAAATCGCGCGGCATCATCATTTGCGATACCA
AATTTGAATTCGGTTTGGATGAAGAAGGTACGCTGACGCTGATGGATGAG
GTATTGACTCCCGATTCGAGCCGCTTCTGGCCGGCGGATCAATATGAAGT
CGGCACCAATCCGCCGTCTTTTGACAAACAATTCGTCCGCGACTGGCTGG
AACAAAGCGGTTGGAACAAAAAAGCCCCTGCGCCTAAAGTGCCTGCCGAT
GTAATTCGGAAAACGGTCGAGAAATATCAGGAAGCATTGACTTTACTGAC
ACAAGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy