Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0274 IGR0276 IGR0280 IGR0273 IGR0278 IGR0275 IGR0272 IGR0281 IGR0279 IGR0277 IGR0271.1 hfq, - NG0326 NG0337 NG0330 NG0336 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0331 bcp, - NG0328 xerD, - NG0329 purC, - NG0333 pnp, - NG0335 hfq, - NG0326 NG0337 NG0330 NG0336 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0331 bcp, - NG0328 xerD, - NG0329 purC, - NG0333 pnp, - NG0335 hfq, - NG0326 NG0330 NG0336 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0337 NG0331 bcp, - NG0328 xerD, - NG0329 purC, - NG0333 pnp, - NG0335
* Calculated from Protein Sequence

Gene ID: NG0332

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rmlD  rfbD  

Definition:
dTDP-4-dehydrorhamnose reductase (dTDP-L-rhamnose synthase) (dTDP-6-deoxy-L-mannose-dehydrogenase) (dTDP-4-keto-L-rhamnose reductase)

Gene Start:
328509

Gene Stop:
327649

Gene Length:
861

Molecular Weight*:
31246

pI*:
6.20

Net Charge*:
-3.50

EC:
1.1.1.133  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Nucleotide sugars metabolism

Secondary Evidence:
Stevenson,G., Neal,B., Liu,D., Hobbs,M., Packer,N.H., Batley,M.,
Redmond,J.W., Lindquist,L. and Reeves,P.
Structure of the O antigen of Escherichia coli K-12 and the
sequence of its rfb gene cluster
J. Bacteriol. 176 (13), 4144-4156 (1994)
Medline: 94292435


Comment:
For other 'rfb' genes see NG1897 (rfbB)and NG1898 (rfbA).

Oklahoma ID: NGO.332c

Blast Summary:  PSI-Blast Search
NG0332 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative dTDP-4-dehydrorhamnose reductase protein: residues 1-287 are 94% similar to residues 1-287 of NG0332. NG0332 is orthologously related to AE002429, Neisseria meningitidis, strain MC58, a putative dTDP-L-rhamnose synthase protein: residues 1-279 are 93% similar to residues 1-279 of NG0332.

Numerous significant hits in gapped BLAST; e.g. residues 1-287 are 47% similar to gb|AAC00179.1| putative dTDP-L-rhamnose synthase of Serratia marcescens, residues 2-282 are 44% similar to 5545319 dTDP-4-keto-L-rhamnose reductase of Actinobacillus actinomycetemcomitans, residues 1-287 are 38% similar to 1314582 dTDP-6-deoxy-L-mannose-dehydrogenase of Sphingomonas sp. S88.


COGS Summary:  COGS Search
BeTs to 8 clades of COG1091
COG name: dTDP-4-dehydrorhamnose reductase
Functional Class:  M
The phylogenetic pattern of COG1091 is --tk-q-cebr---------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-279 are 41% similar to a (PROTEIN OXIDOREDUCTASE DEHYDROGENASE REDUCTASE NAD NADP) protein domain (PD000038) which is seen in O66251_BBBBB.



Paralogs:  Local Blast Search


NG0332 is paralogously related to NG1897 (dTDP-glucose 4,6-dehydratase) (4e-06).


Pfam Summary:  Pfam Search
Residues 3 to 280 (E-value = 7.1e-09) place NG0332 in the Epimerase family which is described as NAD dependent epimerase/dehydratase family (PF01370)
Residues 139 to 279 (E-value = 5.2e-71) place NG0332 in the RmlD_sub_bind family which is described as RmlD substrate binding domain (PF04321)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
93

PDB Hit:
pdb|1KBZ|1KBZ-A CRYSTAL STRUCTURE OF 162.0 5e-41

Gene Protein Sequence:
MRILLTGSKSQLAHCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQ
PDAIVNTAAYTAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHIST
DYVFDGKGKIPYQESDFTNPSNVYGQSKTAGELLALSANPDSLILRTSWL
FSEYGDNFVRTMLNLARERSPLSAVHNQIGCPTYAGDLSAAIIRLLQQSN
PVRGIYHYAGGKSVSWYEFARHIFQTALQQDASFPVPELKAVSDEGSAAA
APRPAYSILDCRKIENDFGIKPSDWQKALAQVVSKLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAATCCTATTGACAGGCTCGAAAAGCCAACTGGCACACTGCCTGCG
CGACCGTCTTCCTGAAGACTGGGAAACCATTGCGACGGATTCCGCATCCC
TAGACATTACCGATGCCGATGCCGTCTGCAACATGGTCAAAAGTTTCCAA
CCCGACGCTATTGTCAACACGGCTGCCTATACTGCCGTCGACAAAGCGGA
AGGCGATGCGGCAGCGGCATTTGCCGTCAATGCTTCCGCCGTTTACAACC
TTGCCTTGGCAGCACATCGCGCCCATGCCCGATTCATCCACATCTCAACC
GACTATGTCTTTGACGGAAAAGGGAAAATACCCTATCAGGAAAGCGACTT
TACCAACCCTTCCAATGTATACGGACAATCCAAAACCGCCGGCGAACTGC
TCGCACTGTCTGCCAATCCCGACAGCCTTATCCTGCGGACTTCTTGGCTG
TTTAGCGAATACGGGGACAACTTTGTCCGCACGATGCTGAACCTTGCGCG
GGAACGTTCCCCGCTGTCCGCCGTCCACAACCAAATCGGCTGCCCGACCT
ATGCCGGCGACTTGTCCGCCGCCATCATCCGCCTGTTGCAGCAGTCCAAT
CCCGTTCGCGGCATTTACCACTACGCCGGCGGCAAATCCGTATCCTGGTA
CGAATTTGCCCGGCACATCTTTCAGACGGCATTGCAACAGGATGCCTCTT
TTCCCGTTCCCGAACTGAAAGCCGTTTCGGATGAAGGCTCTGCGGCTGCC
GCCCCCAGGCCCGCATACAGCATTTTGGACTGCCGCAAAATCGAAAACGA
CTTCGGCATCAAACCGTCAGACTGGCAAAAAGCCCTTGCACAGGTCGTTT
CCAAGCTGCTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy