Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0270 IGR0267 IGR0274 IGR0271 IGR0276 IGR0273 IGR0266 IGR0278 IGR0275 IGR0272 IGR0269 IGR0268 IGR0277 IGR0271.1 NG0325 hfq, - NG0326 NG0330 NG0324 folK, - NG0323 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0319 NG0331 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 purC, - NG0333 NG0325 hfq, - NG0326 NG0330 NG0324 folK, - NG0323 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0319 NG0331 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 purC, - NG0333 NG0325 hfq, - NG0326 NG0330 folK, - NG0323 rmlD,rfbD, - NG0332 pbp4, - NG0327 NG0319 NG0324 NG0331 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 purC, - NG0333
* Calculated from Protein Sequence

Gene ID: NG0327

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pbp4  

Definition:
penicillin-binding protein 4 (D-alanyl-D-alanine-endopeptidase)

Gene Start:
324986

Gene Stop:
323880

Gene Length:
1107

Molecular Weight*:
40748

pI*:
10.30

Net Charge*:
13.97

EC:
3.4.99.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table

Secondary Evidence:
Henderson,T.A., Templin,M. and Young,K.D.
Identification and cloning of the gene encoding penicillin-binding
protein 7 of Escherichia coli
J. Bacteriol. 177 (8), 2074-2079 (1995)
Medline: 95238279


Comment:
Oklahoma ID: NGO.327c

PBP-7 in E.coli is a close relative.

Blast Summary:  PSI-Blast Search
NG0327 is similar to a previously sequenced N.gonorrhoeae protein in GenBank, 5053120, a predicted penicillin-binding protein 4: residues 1-312 are 99% similar to residues 58-369 of NG0327.

NG0327 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative D-alanyl-D-alanine-endopeptidase protein: residues 1-312 are 98% similar to residues 58-369 of NG0327. NG0327 is orthologously related to AE002429, Neisseria meningitidis, strain MC58, a penicillin-binding protein 4: residues 1-312 are 98% similar to residues 58-369 of NG0327.

Numerous significant hits to penicillin-binding proteins in gapped BLAST; e.g. residues 127-364 are 43% similar to 12230964 penicillin-binding protein 5 precursor (PBP-5) (D-alanyl-D-alanine-endopeptidase) (DD-endopeptidase) of Pseudomonas aeruginosa, residues 127-364 are 42% similar to gb|AAC75195.1| penicillin-binding protein 7 of Escherichia coli K12, residues 129-353 are 34% similar to 1172032 penicillin-binding protein 7 homolog precursor (PBP-7) (D-alanyl-D-alanine endopeptidase) (DD-endopeptidase) of Haemophilus influenzae.


COGS Summary:  COGS Search
BeTs to 7 clades of COG1686
COG name: D-alanyl-D-alanine carboxypeptidase
Functional Class:  M
The phylogenetic pattern of COG1686 is --------EBRH----olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR00725 (D-Ala-D-Ala carboxypeptidase 1 (S11) family signature) with a combined E-value of 1.3e-13.
    PR00725A    155-166
    PR00725B    205-222
    PR00725C    232-245


ProDom Summary:  Protein Domain Search
Residues 129-206 are 38% similar to a (PENICILLIN-BINDING PROTEIN 7 HOMOLOG) protein domain (PD102661) which is seen in PBP7_HAEIN.

Residues 127-206 are 45% similar to a (CARBOXYPEPTIDASE PROTEIN PRECURSOR) protein domain (PD003893) which is seen in PBP5_PSEAE.

Residues 210-363 are 43% similar to a (PROTEIN CARBOXYPEPTIDASE PENICILLIN-BINDING PRECURSOR) protein domain (PD003024) which is seen in PBP5_PSEAE.



Paralogs:  Local Blast Search


NG0327 is paralogously related to NG0443 (penicillin-binding protein (D-alanyl-D-alanine carboxypeptidase)) (3e-14).


Pfam Summary:  Pfam Search
Residues 118 to 349 (E-value = 3.9e-50) place NG0327 in the Peptidase_S11 family which is described as D-alanyl-D-alanine carboxypeptidase (PF00768)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
69  
85
transmembrane  
151  
167

PDB Hit:
pdb|1ES4|1ES4-A C98N MUTANT OF STREPTOMYCES K15 84.7 2e-17
pdb|1ES3|1ES3-A C98A MUTANT OF STREPTOMYCES K15 81.5 2e-16
pdb|1SKF|1SKF CRYSTAL STRUCTURE OF THE STREPTOMYCES K15 81.1 3e-16
pdb|1ES5|1ES5-A S216

Gene Protein Sequence:
MSNHKICSDLKTECYKTQLQKHNKTARLRAVSCQTTYFTDGCFFNKITPI
LKNTEPKMSIRTLKRLPSSLLLGLCLSLPSAHLFADNDILGQFLEQNMLT
SSDPIEIFAESTIYPADTQAITGGLILSSQSALVVNNKTGQILYQKNADR
IMPIASISKLMSAMVVLDANLDMNETVTITPDEIDRLKGTGSRLAIGTAL
TRKELLHLSLMSSENRATHALGRTYPGGMGAFVAAMNRKAQSLGMYGSRF
YEPTGLNFQNVSTAKDLSLMVNAAAQYPQIRTNSTSNYASVQTKNGQQNY
KNSNALVREGMWNIELQKTGYIREAGRSMVVKANIQNQPVTIVLLNSPTS
ATRVNDARKIESWMLQQRS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAACCACAAAATATGTTCCGATTTAAAAACAGAATGTTATAAAAC
CCAACTCCAAAAACACAACAAGACCGCCCGCCTACGGGCAGTCTCCTGTC
AGACGACATACTTTACAGATGGCTGTTTTTTCAACAAAATAACGCCAATA
CTCAAAAATACGGAACCAAAAATGTCCATCCGCACCCTGAAACGCCTGCC
CTCATCGCTGCTGCTCGGCCTCTGCCTTTCCCTGCCGTCAGCCCACCTTT
TTGCCGACAACGACATTTTAGGGCAATTTTTAGAACAGAACATGCTTACC
TCCTCCGATCCGATAGAAATATTCGCCGAAAGCACGATATATCCCGCCGA
TACCCAGGCCATTACGGGCGGGCTGATTCTGTCCTCCCAATCCGCACTGG
TCGTCAACAACAAAACAGGGCAAATACTGTATCAGAAAAACGCCGACAGG
ATTATGCCCATTGCCTCCATTTCCAAGCTCATGAGCGCGATGGTCGTTTT
GGATGCAAACTTGGACATGAACGAAACCGTTACCATCACACCCGACGAAA
TCGACCGCCTCAAAGGGACCGGCAGCCGTCTTGCCATAGGTACGGCACTT
ACACGTAAAGAACTGCTGCACCTTAGCCTGATGAGCAGCGAAAACCGCGC
CACCCATGCATTGGGCAGAACCTACCCCGGCGGCATGGGCGCATTTGTCG
CCGCCATGAACCGCAAAGCCCAAAGCCTGGGCATGTACGGCAGCCGCTTT
TACGAACCGACCGGACTCAACTTCCAAAACGTTTCCACCGCCAAAGACCT
GAGCCTCATGGTCAACGCCGCCGCCCAATATCCGCAAATCCGCACCAACT
CGACTTCCAACTACGCCTCGGTACAAACCAAAAACGGGCAGCAAAACTAT
AAAAACTCCAATGCCCTGGTCAGGGAAGGCATGTGGAACATCGAATTGCA
GAAAACCGGCTACATCCGCGAGGCAGGCAGGTCTATGGTTGTCAAAGCCA
ACATTCAAAACCAACCCGTTACCATCGTATTGCTGAACTCGCCCACATCC
GCCACACGCGTCAACGACGCCCGCAAAATCGAATCGTGGATGCTGCAGCA
ACGCTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy