Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-1 tRNA-Arg-1 IGR0270 IGR0267 IGR0274 IGR0271 IGR0276 IGR0273 IGR0266 IGR0275 IGR0272 IGR0269 IGR0268 IGR0271.1 IGR0265 NG0325 hfq, - NG0326 NG0330 NG0324 folK, - NG0323 pbp4, - NG0327 NG0319 NG0331 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 recN, - NG0318 NG0325 hfq, - NG0326 NG0330 NG0324 folK, - NG0323 pbp4, - NG0327 NG0319 NG0331 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 recN, - NG0318 Type: tandem, Name:  - 16 NG0325 hfq, - NG0326 NG0330 folK, - NG0323 pbp4, - NG0327 NG0319 NG0324 NG0331 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 recN, - NG0318
* Calculated from Protein Sequence

Gene ID: NG0323

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folK  

Definition:
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine-pyrophosphokinase

Gene Start:
322366

Gene Stop:
321875

Gene Length:
492

Molecular Weight*:
18201

pI*:
5.70

Net Charge*:
-3.09

EC:
2.7.6.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Comment:
Oklahoma ID: NGO.323c

For other 'fol' genes, see NG0267 (folI), NG0266 (folC), NG0857 (folB), NG1342 (folP), NG1694 (folA), NG1999 (folD).

Blast Summary:  PSI-Blast Search
NG0323 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase protein: residues 1-164 are 94% similar to residues 1-164 of NG0323.

Numerous significant hits to 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (7,8-Dihydro-6-Hydroxymethylpterin-Pyrophosphokinase) in gapped BLAST; e.g. residues 1-158 are 42% similar to 7480772 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase of Streptomyces coelicolor, residues 7-155 are 43% similar to 1073802 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase of Haemophilus influenzae (strain Rd KW20).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0801
COG name: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Functional Class:  H
The phylogenetic pattern of COG0801 is ----yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000550 (7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase) with a combined E-value of 7.7e-42.
    IPB000550A    7-21
    IPB000550B    54-77
    IPB000550C    81-104
    IPB000550D    114-131


ProDom Summary:  Protein Domain Search
Residues 7-137 are 42% similar to a (PYROPHOSPHOKINASE TRANSFERASE) protein domain (PD003866) which is seen in HPPK_HAEIN.



Paralogs:  Local Blast Search


NG0323 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 135 (E-value = 9.3e-56) place NG0323 in the HPPK family which is described as 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) (PF01288)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
19

PDB Hit:
pdb|1CBK|1CBK-A 103.0 2e-23
pdb|1DY3|1DY3-A TERNARY COMPLEX OF 86.6 2e-18
pdb|1CBK|1CBK-A 221.0 6e-59
pdb|1DY3|1DY3-A TERN

Gene Protein Sequence:
MNNRHFAVIALGSNLDNPAQQIRGALDALSSHPDIRLEQASSLYMTAPVG
YDNQPDFINAVCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLD
IIDFDGISSDDPRLTLPHPRAHERSFVIRPLAEILPDFILGKYGKVVELS
KRLGNQGIRLLPDR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAACAGACATTTTGCCGTCATCGCCTTGGGCAGCAACCTTGACAA
CCCCGCACAACAAATACGCGGCGCATTAGACGCGCTCTCGTCCCATCCTG
ACATCCGGCTTGAACAGGCTTCCTCACTGTATATGACCGCACCCGTCGGT
TACGACAATCAGCCCGATTTCATCAATGCCGTCTGCACCGTTTCCACCAC
CTTGGACGGCATTGCCCTGCTTGCCGAACTCAACCGTATCGAAGCCGATT
TCGGACGCGAACGCAGTTTCCGCAATGCACCGCGCACATTGGATTTGGAC
ATTATCGACTTTGACGGCATCTCCAGCGACGACCCCCGCCTTACCCTGCC
GCATCCGCGCGCGCACGAACGCAGTTTCGTCATACGCCCTTTGGCAGAAA
TCCTCCCTGATTTTATTTTGGGAAAATACGGAAAGGTTGTCGAATTGTCA
AAACGGCTGGGCAATCAAGGCATCCGTCTTTTACCGGACAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy