Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-1 tRNA-Arg-1 IGR0270 IGR0267 IGR0274 IGR0271 IGR0273 IGR0266 IGR0272 IGR0269 IGR0264 IGR0268 IGR0271.1 IGR0265 NG0325 hfq, - NG0326 NG0324 folK, - NG0323 pbp4, - NG0327 NG0319 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 recN, - NG0318 NG0325 hfq, - NG0326 NG0324 folK, - NG0323 pbp4, - NG0327 NG0319 NG0320 NG0322 bcp, - NG0328 ubiE, - NG0321 xerD, - NG0329 recN, - NG0318 Type: tandem, Name:  - 16 NG0325 hfq, - NG0326 folK, - NG0323 pbp4, - NG0327 NG0319 NG0324 NG0320 NG0322 ubiE, - NG0321 xerD, - NG0329 recN, - NG0318 bcp, - NG0328
* Calculated from Protein Sequence

Gene ID: NG0321

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ubiE  

Definition:
ubiquinone/menaquinone biosynthesis methlytransferase

Gene Start:
320308

Gene Stop:
321042

Gene Length:
735

Molecular Weight*:
27387

pI*:
8.00

Net Charge*:
2.17

EC:
2.1.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Comment:
Oklahoma ID: NGO.321

For other 'ubi' genes, see NG0312 (ubiA), NG2074 (ubiG), NG2140 (ubiX).

Blast Summary:  PSI-Blast Search
NG0321 is orthologously related to AE002429, Neisseria meningitidis, strain MC58, a ubiquinone/menaquinone biosynthesis methlytransferase UbiE protein: residues 1-245 are 98% similar to residues 1-245 of NG0321.

Numerous significant hits in gapped BLAST; e.g. residues 6-244 are 64% similar to gb|AAG08448.1|AE004919_9 ubiquinone biosynthesis methyltransferase UbiE of Pseudomonas aeruginosa, residues 4-245 are 62% similar to dbj|BAB38186.1| ubiquinone/menaquinone biosynthesis methyltransferase of Escherichia coli O157:H7, residues 4-245 are 61% similar to gb|AAF93261.1| biquinone/menaquinone biosynthesis methlytransferase UbiE of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG2226
COG name: Methylase involved in ubiquinone/menaquinone biosynthesis UbiE/COQ5
Functional Class:  H
The phylogenetic pattern of COG2226 is ----yqvcebr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000339 (ubiE/COQ5 methyltransferase family) with a combined E-value of 3.4e-97.
    IPB000339A    22-49
    IPB000339B    63-77
    IPB000339C    87-104
    IPB000339D    126-168
    IPB000339E    177-207
    IPB000339F    222-244


ProDom Summary:  Protein Domain Search
Residues 17-75 are 66% similar to a (METHYLTRANSFERASE BIOSYNTHESIS UBIQUINONE) protein domain (PD006106) which is seen in Q9Z439_PSEPU.

Residues 204-244 are 75% similar to a (METHYLTRANSFERASE UBIQUINONE BIOSYNTHESIS) protein domain (PD008172) which is seen in Q9Z439_PSEPU.

Residues 87-203 are 60% similar to a (PROTEIN METHYLTRANSFERASE TRANSFERASE BIOSYNTHESIS) protein domain (PD000198) which is seen in Q9Z439_PSEPU.



Paralogs:  Local Blast Search


NG0321 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 244 (E-value = 7.4e-112) place NG0321 in the Ubie_methyltran family which is described as ubiE/COQ5 methyltransferase family (PF01209)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MGGQKTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKH
FTIHTAHLKKGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTV
GRDRLLNEGMILPVSLADAEKLPFPDNYFNLVSVAFGLRNMTYKDAALKE
MYRVLKPGGTLLVLEFSKIYKPLEGAYDFYSFKLLPVMGRLIAKDADSYQ
YLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVALHKGVKF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCGGACAAAAAACGCATTTCGGGTTCAGCACGGTCAACGAAGATGA
GAAAGCCGGAAAAGTGGCGGAAGTGTTTCACTCCGTCGCCAAAAACTACG
ACATTATGAATGATGTGATGTCGGCAGGGCTGCACCGCGTATGGAAGCAT
TTTACCATCCATACGGCGCACCTGAAAAAAGGCGATAAAGTGTTGGACAT
TGCGGGCGGTACGGGCGATTTGTCGCGCGGTTGGGCGAAACGGGTCGGCA
AGGAAGGCGAGGTTTGGCTGACCGATATTAATTCTTCTATGCTGACCGTC
GGGCGCGACCGTCTGTTGAACGAAGGCATGATTTTACCCGTGTCGCTTGC
CGATGCGGAAAAACTGCCTTTCCCCGACAATTATTTCAACTTGGTCTCCG
TGGCGTTCGGCTTGCGGAACATGACGTATAAAGATGCCGCGCTTAAGGAA
ATGTACCGTGTTTTGAAACCGGGCGGTACGTTGCTGGTGTTGGAGTTTTC
CAAAATCTACAAGCCGCTCGAAGGCGCATACGATTTTTATTCTTTCAAGC
TGTTGCCGGTAATGGGCAGGCTGATTGCCAAAGATGCGGACAGCTACCAG
TATCTCGCCGAATCCATCCGTATGCACCCCGATCAGGAAACTTTGAAACA
GATGATGCTGGATGCAGGCTTCGACAGCGTGGATTATCACAATATGAGTG
CGGGCATCGTCGCGCTGCATAAGGGCGTGAAATTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy