Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0261 IGR0262 IGR0263 IGR0259 IGR0257 IGR0258 IGR0264 IGR0260 IGR0258.1 NG0307.1 NG0306 ptsN, - NG0313 NG0307 NG0317 bioD, - NG0309 ubiA, - NG0312 ylqF, - NG0316 hprK, - NG0314 bioA, - NG0308 recN, - NG0318 NG0307.1 NG0306 ptsN, - NG0313 NG0307 NG0317 bioD, - NG0309 ubiA, - NG0312 ylqF, - NG0316 hprK, - NG0314 bioA, - NG0308 recN, - NG0318 Type: tandem, Name:  - 15 ptsN, - NG0313 NG0307 bioD, - NG0309 ubiA, - NG0312 ylqF, - NG0316 hprK, - NG0314 bioA, - NG0308 recN, - NG0318 himA,ihfA, - NG0305 NG0311 NG0310 NG0315 NG0311 NG0310 NG0315 NG0307.1 NG0306 NG0317 himA,ihfA, - NG0305
* Calculated from Protein Sequence

Gene ID: NG0312

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ubiA  

Definition:
4-hydroxybenzoate octaprenyltransferase

Gene Start:
310506

Gene Stop:
311393

Gene Length:
888

Molecular Weight*:
33210

pI*:
9.90

Net Charge*:
8.47

EC:
2.5.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Electron Transport System, Complex IV
Glycoprotein biosynthesis
Porphyrin and chlorophyll metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Wu,G., Williams,H.D., Gibson,F. and Poole,R.K. 1993.
Mutants of Escherichia coli affected in respiration: the cloning and nucleotide sequence of ubiA, encoding the membrane-bound
p-hydroxybenzoate:octaprenyltransferase.
J. Gen. Microbiol. 139 (Pt 8): 1795-1805.
Medline: 94014977.

Kobayashi T, Kishigami S, Sone M, Inokuchi H, Mogi T, Ito K.
Respiratory chain is required to maintain oxidized states of the DsbA-DsbB disulfide bond formation system in aerobically growing Escherichia coli cells.
Proc Natl Acad Sci U S A. 1997 Oct 28;94(22):11857-62.
PMID: 9342327

Melzer,M. and Heide,L. Characterization of polyprenyldiphosphate: 4-hydroxybenzoate polyprenyltransferase
from Escherichia coli.
Biochim. Biophys. Acta 1212(1): 93-102, 1994.
Medline: 94207029.

Siebert,M., Bechthold,A., Melzer,M., May,U., Berger,U., Schroder,G., Schroder,J., Severin,K. and Heide,L.
Ubiquinone biosynthesis. Cloning of the genes coding for chorismate pyruvate-lyase and 4-hydroxybenzoate
octaprenyl transferase from Escherichia coli.
FEBS Lett. 307(3): 347-350, 1992.
Medline: 92354744.


Comment:
Oklahoma ID: NGO.312

For other 'ubi' genes, see NG0321 (ubiE), NG2074 (ubiG), NG2140 (ubiX).

Blast Summary:  PSI-Blast Search
NG0312 is orthologously related to AE002428, Neisseria meningitidis, strain MC58, a 4-hydroxybenzoate octaprenyltransferase protein: residues 1-296 are 96% similar to residues 1-296 of NG0312.

Numerous significant hits in gapped BLAST; e.g. residues 13-288 are 50% similar to gb|AAC77010.1| 4-hydroxybenzoate-octaprenyltransferase of Escherichia coli K12, residues 18-289 are 48% similar to gb|AAB88868.1| 4-hydroxybenzoate octaprenyltransferase of Providencia stuartii, residues 7-288 are 44% similar to gb|AAF82881.1|AE003860_8 hydroxybenzoate octaprenyltransferase of Xylella fastidiosa.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0382
COG name: 4-hydroxybenzoate octaprenyltranferase
Functional Class:  H
The phylogenetic pattern of COG0382 is AmTkyq-Ce---uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000537 (UbiA prenyltransferase) with a combined E-value of 3.7e-30.
    IPB000537A    59-101
    IPB000537B    136-166


ProDom Summary:  Protein Domain Search
Residues 141-258 are 47% similar to a (TRANSFERASE 4-HYDROXYBENZOATE OCTAPRENYLTRANSFERASE) protein domain (PD124505) which is seen in UBIA_ECOLI.

Residues 42-139 are 44% similar to a (TRANSFERASE PROTEIN SYNTHASE TRANSMEMBRANE) protein domain (PD001657) which is seen in UBIA_ECOLI.



Paralogs:  Local Blast Search


NG0312 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 30 to 292 (E-value = 2.4e-67) place NG0312 in the UbiA family which is described as UbiA prenyltransferase family (PF01040)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
48  
64
non-globular  
101  
195
transmembrane  
101  
117
transmembrane  
151  
167
transmembrane  
227  
243

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNLKSPLFLRLSDRLDVYIRLMRADKPIGTLLLLWPTYWALWLASDGIPD
LAVLAAFTIGTFLMRSAGCVINDFADRDFDGAVERTKNRPFAQGRVKKKE
ALLLTAFLCLLAALCLIPLNHLTWLMSLPALFLALTYPFTKRFFPIPQFY
LGFAFSFGIPMAFAAVGNSVPVEAWILFAANVLWTLAYDTVYAMADKEDD
LKIGIKTSAVTFGRYDIAAVMLCHGGFTLLMAVLGAVIGAAWAYWTAIPI
VLLLQYRQYAAIKSRVRQICFETFLANNRIGWVWFAAIFAHTFFAK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCTTAAATCCCCTTTATTTTTACGACTGTCCGATCGTTTGGACGT
TTATATCAGACTGATGAGGGCGGACAAGCCCATTGGGACGCTGCTTTTAC
TGTGGCCGACCTACTGGGCATTGTGGCTGGCTTCAGACGGCATTCCCGAT
TTGGCGGTATTGGCGGCGTTTACAATCGGCACGTTTTTAATGCGCAGTGC
CGGCTGCGTCATCAACGACTTTGCCGACCGCGATTTTGACGGTGCTGTCG
AGCGCACCAAAAACCGTCCGTTCGCACAGGGCAGGGTCAAGAAAAAAGAA
GCCCTGCTGCTGACGGCATTTTTGTGTCTGCTTGCCGCATTGTGCCTGAT
TCCGCTGAATCATCTGACATGGCTGATGAGCCTGCCCGCGCTGTTCCTTG
CGCTGACTTACCCGTTTACCAAACGCTTTTTTCCGATTCCCCAATTTTAT
CTGGGATTTGCCTTTTCCTTCGGCATCCCGATGGCGTTTGCCGCAGTGGG
CAACAGCGTTCCCGTTGAAGCGTGGATACTCTTTGCCGCCAATGTTTTAT
GGACACTGGCTTACGATACCGTCTATGCAATGGCGGACAAAGAGGACGAT
TTGAAAATCGGCATCAAAACCTCCGCCGTCACGTTCGGGCGTTACGACAT
CGCCGCCGTTATGCTGTGTCATGGCGGCTTTACCCTGCTGATGGCAGTAT
TGGGTGCGGTTATCGGTGCGGCATGGGCATATTGGACGGCAATCCCCATC
GTCCTGCTGCTGCAATACCGCCAATATGCCGCAATCAAAAGCCGCGTCCG
GCAAATCTGTTTTGAAACGTTTTTGGCAAACAACAGAATCGGTTGGGTGT
GGTTTGCCGCTATTTTTGCCCATACGTTTTTCGCGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy