Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0261 IGR0256 IGR0262 IGR0259 IGR0257 IGR0258 IGR0260 IGR0258.1 NG0307.1 NG0306 ptsN, - NG0313 NG0307 bioD, - NG0309 ubiA, - NG0312 ylqF, - NG0316 hprK, - NG0314 bioA, - NG0308 pheT, - NG0304 NG0307.1 NG0306 ptsN, - NG0313 NG0307 bioD, - NG0309 ubiA, - NG0312 ylqF, - NG0316 hprK, - NG0314 bioA, - NG0308 pheT, - NG0304 Type: tandem, Name:  - 15 ptsN, - NG0313 NG0307 bioD, - NG0309 ubiA, - NG0312 hprK, - NG0314 bioA, - NG0308 pheT, - NG0304 himA,ihfA, - NG0305 NG0311 NG0310 NG0315 NG0311 NG0310 NG0315 ylqF, - NG0316 NG0307.1 NG0306 himA,ihfA, - NG0305
* Calculated from Protein Sequence

Gene ID: NG0309

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bioD  

Definition:
dethiobiotin synthase (dethiobiotin synthetase)

Gene Start:
308847

Gene Stop:
309491

Gene Length:
645

Molecular Weight*:
23662

pI*:
6.60

Net Charge*:
-1.93

EC:
6.3.3.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Schneider G, Lindqvist Y.
Structure of ATP-dependent carboxylase, dethiobiotin synthase.
Methods Enzymol. 1997;279:376-85. Review. No abstract available.
PMID: 9211290

Sakurai N, Akatsuka H, Kawai E, Imai Y, Komatsubara S.
Complete sequence and organization of the Serratia marcescens biotin operon.
Microbiology. 1996 Nov;142 ( Pt 11):3295-303.
PMID: 8969526

Comment:
Oklahoma ID: NGO.309

For other 'bio' genes, see NG0308 (bioA), NG0813 (bioB), NG1481 (bioC), NG1483 (bioF), NG1725 (bioH).

Blast Summary:  PSI-Blast Search
NG0309 is orthologously related to AE002428, Neisseria meningitidis, strain MC58, a dethiobiotin synthase protein: residues 1-215 are 91% similar to residues 1-215 of NG0309.

Numerous significant hits to dethiobiotin synthase (dethiobiotin synthetase) in gapped BLAST; e.g. residues 1-175 are 55% similar to gb|AAC23200.1| dethiobiotin synthase of Haemophilus influenzae Rd, residues 5-177 are 36% similar to dbj|BAB04502.1| dethiobiotin synthetase of Bacillus halodurans, residues 5-208 are 34% similar to gb|AAB52912.1| dethiobiotin synthetase of Erwinia herbicola.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0132
COG name: Dethiobiotin synthetase
Functional Class:  H
The phylogenetic pattern of COG0132 is -m--yq-cEbrHuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-175 are 55% similar to a (DETHIOBIOTIN SYNTHETASE SYNTHASE DTB) protein domain (PD003986) which is seen in BID2_HAEIN.



Paralogs:  Local Blast Search


NG0309 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1DTS|1DTS DETHIOBIOTIN SYNTHASE (E.C.6.3.3.3) 98.3 1e-21
pdb|1A82|1A82 DETHIOBIOTIN SYNTHETASE FROM ESCHERICHIA COLI, 97.1 2e-21
pdb|1DTS|1DTS DETHIOBIOTIN SYNTHASE (E.C.6.3.3.3) 316.0 3e-87
pdb|1A82|1A82 DETHI

Gene Protein Sequence:
MKGVYFVSGIDTDIGKTVATGMLAKQLLQQGKSVITQKPVQTGCQDIAED
IAVHRKIMGIPMQEADEQRLTMPEIFSHPASPHLAARLDGRGLDLDKIRT
ATQELAAQYEVVLVEGAGGLMVPLTEKLLTIDHIQQQAYPVILVTSGRLG
SINHTLLSFVVLKQYGIRLHSLVFNHIHDSRDAHVAQDSLNYLQCRLKAD
FPEAEWMELAKTGAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGCGTTTACTTCGTCAGCGGTATAGACACGGACATCGGCAAAAC
CGTCGCCACCGGTATGTTGGCAAAACAATTGTTGCAGCAGGGCAAAAGCG
TGATTACGCAAAAGCCCGTGCAAACCGGTTGCCAAGACATCGCCGAAGAC
ATCGCCGTCCACCGTAAAATCATGGGCATACCCATGCAGGAAGCTGATGA
ACAGCGTCTGACTATGCCTGAAATCTTCAGCCATCCCGCCTCGCCCCACC
TTGCCGCCCGACTGGACGGCAGGGGTTTGGACTTGGACAAAATCCGCACC
GCCACACAAGAATTGGCGGCGCAGTACGAAGTCGTTTTGGTCGAAGGCGC
GGGCGGGTTGATGGTACCACTGACGGAAAAGCTGTTAACCATTGATCATA
TTCAGCAACAGGCTTATCCCGTCATCCTTGTTACCAGCGGACGGCTGGGA
AGCATTAATCACACCCTGCTCAGTTTCGTCGTGCTCAAACAATACGGCAT
TCGCCTGCACAGCCTCGTGTTTAACCACATCCACGACAGCCGCGACGCAC
ACGTCGCCCAAGACAGCCTGAACTATCTGCAATGCCGTCTGAAAGCCGAT
TTTCCCGAAGCGGAATGGATGGAGTTGGCAAAAACAGGCGCGGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy