Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0261 IGR0256 IGR0255 IGR0259 IGR0257 IGR0258 IGR0260 IGR0258.1 NG0307.1 NG0306 ptsN, - NG0313 NG0307 bioD, - NG0309 ubiA, - NG0312 hprK, - NG0314 bioA, - NG0308 pheT, - NG0304 NG0307.1 NG0306 ptsN, - NG0313 NG0307 bioD, - NG0309 ubiA, - NG0312 hprK, - NG0314 bioA, - NG0308 pheT, - NG0304 Type: tandem, Name:  - 15 ptsN, - NG0313 NG0307 bioD, - NG0309 ubiA, - NG0312 hprK, - NG0314 bioA, - NG0308 pheT, - NG0304 himA,ihfA, - NG0305 NG0311 NG0310 NG0315 NG0311 NG0310 NG0315 NG0307.1 NG0306 himA,ihfA, - NG0305
* Calculated from Protein Sequence

Gene ID: NG0308

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bioA  

Definition:
adenosylmethionine-8-amino-7-oxononanoate aminotransferase

Gene Start:
307549

Gene Stop:
308847

Gene Length:
1299

Molecular Weight*:
47958

pI*:
6.60

Net Charge*:
-3.27

EC:
2.6.1.62  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Comment:
Oklahoma ID: NGO.308

For other 'bio' genes, see NG0309 (bioD), NG0813 (bioB), NG1481 (bioC), NG1483 (bioF), NG1725 (bioH).

For other aminotransferases, see NG0082 (avtA), NG2045 (glmS), NG0460, NG0646 (argD), NG1047 (aat), NG1241 (hisC), NG1283 (serC), NG1329 (tyrB), NG1452 (aspC).

Blast Summary:  PSI-Blast Search
NG0308 is orthologously related to AE002428, Neisseria meningitidis, strain MC58, a adenosylmethionine-8-amino-7-oxononanoate aminotransferase protein: residues 1-433 are 97% similar to residues 1-433 of NG0308.

Numerous significant hits in gapped BLAST; e.g. residues 10-430 are 59% similar to gb|AAC23203.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase (bioA) of Haemophilus influenzae Rd, residues 4-430 are 59% similar to 12722332 BioA of Pasteurella multocida, residues 8-422 are 58% similar to gb|AAC44533.1| adenosylmethionine-8-amino-7-oxononanoate transaminase of Erwinia herbicola.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0161
COG name: Adenosylmethionine-8-amino-7-oxononanoate aminotranferase
Functional Class:  H
The phylogenetic pattern of COG0161 is -m--yq--eBRhuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000954 (Aminotransferase class-III pyridoxal-phosphate) with a combined E-value of 1.8e-57.
    IPB000954A    45-74
    IPB000954B    223-262
    IPB000954C    271-286
    IPB000954D    313-331


ProDom Summary:  Protein Domain Search
Residues 313-354 are 69% similar to a (AMINOTRANSFERASE TRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD000519) which is seen in BIOA_HAEIN.

Residues 249-299 are 74% similar to a (AMINOTRANSFERASE TRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD000465) which is seen in BIOA_SERMA.

Residues 97-338 are 37% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in OAT_ECOLI.

Residues 127-185 are 64% similar to a (AMINOTRANSFERASE TRANSFERASE) protein domain (PD005247) which is seen in BIOA_HAEIN.

Residues 365-422 are 63% similar to a (ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE) protein domain (PD006634) which is seen in BIOA_ERWHE.

Residues 25-155 are 30% similar to a (AMINOTRANSFERASE TRANSFERASE DNTP-HEXOSE DEDUCED) protein domain (PD032384) which is seen in O66156_BBBBB.

Residues 12-64 are 67% similar to a (ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE) protein domain (PD082147) which is seen in BIOA_ERWHE.

Residues 193-248 are 41% similar to a (AMINOTRANSFERASE TRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD082186) which is seen in BIOA_YEAST.

Residues 66-125 are 70% similar to a (AMINOTRANSFERASE TRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD186083) which is seen in BIOA_HAEIN.



Paralogs:  Local Blast Search


NG0308 is paralogously related to NG0646 (acetylornithine aminotransferase (acetylornitine delta-aminotransferase) / succinylornithine transaminase (succinylornithine aminotransferase) (carbon starvation protein c)) (8e-29) and NG0040 (glutamate 1-semialdehyde 2,1-aminotransferase) (4e-20).


Pfam Summary:  Pfam Search
Residues 24 to 432 (E-value = 1.7e-152) place NG0308 in the Aminotran_3 family which is described as Aminotransferase class-III (PF00202)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
319  
335

PDB Hit:
pdb|1MLY|1MLY-A CRYSTAL STRUCTURE OF 7,8-DIAMINOPELARGONIC ACID 506.0 0e+00
pdb|1MGV|1MGV-A CRYSTAL STRUCTURE OF THE R391A MUTANT OF 7,8- 503.0 0e+00
pdb|1DTY|1DTY-A CRYSTAL STRUCTURE OF 495.0 0e+00
pdb|1GBN|1GBN-A HUMA

Gene Protein Sequence:
MPSEHQHTSSLLNFDRTHLLHPYTSMTDPLPVYPVKRAEGVFIELADGTR
LIDGMSSWWCAIHGYNHPVLNQAVENQMKQMAHVMFGGLTHEPAVELGKL
LVGILPQGLDRIFYADSGSVSVEVALKMAVQYQQARGLTAKQNIATVRRG
YHGDTWNAMSVCDPETGMHHIFGSALPQRYFVDNPKNRFDDEWDGADLQP
VRALFEAHHVDIAAFILEPVVQGAGGMYFYHPQYLRGLRDLCDEFDIVLI
FDEIATGFGRTGKMFACEHAEVVPDIMCIGKGLSGGYMTLAAAITSQKVT
ETISRGEAGVFMHGPTFMANPLACAVACASVKLLLSQDWQANIRRIESIL
KGRLKAAWDIRGVKDVRVLGAIGVIELEKGVDMARFQADCVAQGIWVRPF
GRLVYLMPPYIISDGILTKLADKTVQILKEHSK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAACATCAACACACATCATCATTACTTAATTTCGACCGTAC
CCATCTGCTCCATCCCTATACTTCCATGACCGATCCGCTTCCCGTTTATC
CTGTCAAACGTGCAGAAGGGGTGTTTATCGAATTGGCGGACGGCACGCGG
CTGATTGACGGGATGTCGTCTTGGTGGTGTGCGATACACGGTTACAATCA
TCCCGTTTTGAATCAGGCGGTTGAGAATCAGATGAAACAAATGGCGCACG
TGATGTTCGGCGGCCTGACGCACGAGCCGGCGGTGGAGCTGGGCAAGTTG
TTGGTCGGGATTTTGCCGCAGGGGCTGGACCGTATTTTTTATGCGGATTC
GGGTTCGGTTTCGGTAGAAGTCGCGTTGAAAATGGCGGTGCAATACCAGC
AGGCGCGGGGTCTGACGGCGAAGCAGAATATTGCGACGGTACGGCGCGGG
TATCACGGCGATACTTGGAACGCGATGTCCGTTTGTGATCCGGAAACGGG
GATGCACCATATTTTCGGCAGCGCGTTGCCGCAGCGTTATTTTGTCGATA
ATCCGAAAAACCGTTTCGACGATGAATGGGACGGGGCGGATTTGCAGCCT
GTCCGCGCCTTGTTTGAAGCGCATCATGTGGATATTGCCGCCTTTATTTT
AGAACCGGTCGTGCAAGGCGCGGGCGGCATGTATTTTTATCATCCGCAGT
ATCTTCGCGGCTTGCGCGATTTGTGCGACGAATTTGATATCGTGTTGATT
TTTGACGAAATCGCCACCGGATTCGGGCGCACGGGCAAGATGTTTGCCTG
CGAACACGCGGAGGTCGTGCCGGATATTATGTGTATCGGCAAGGGTTTGA
GCGGCGGCTATATGACGCTGGCGGCGGCAATCACTTCGCAAAAAGTTACC
GAAACGATTTCACGCGGCGAAGCGGGCGTGTTTATGCACGGCCCGACATT
TATGGCGAACCCGCTGGCGTGTGCCGTTGCCTGTGCTTCGGTCAAGCTGC
TTTTATCCCAAGACTGGCAGGCAAATATCCGCCGTATCGAAAGCATCTTA
AAAGGCCGTCTGAAAGCCGCGTGGGACATTCGCGGCGTGAAAGACGTGCG
CGTTTTGGGTGCTATCGGCGTGATAGAGTTGGAAAAAGGCGTGGATATGG
CGCGTTTTCAAGCGGATTGTGTGGCGCAGGGCATTTGGGTACGCCCGTTC
GGCAGGCTGGTGTATCTGATGCCGCCCTATATCATTTCAGACGGCATTTT
GACCAAACTTGCCGATAAAACCGTGCAAATCTTGAAGGAACACAGCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy