Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0254 IGR0250 IGR0252 IGR0256 IGR0255 IGR0249 IGR0251 IGR0257 IGR0258 IGR0258.1 IGR0253 rpmI, - NG0297 NG0307.1 NG0302 NG0306 rplT, - NG0298 hpaIIV,vsr, - NG0300 NG0307 bioD, - NG0309 NG0303 pheS, - NG0299 bioA, - NG0308 pheT, - NG0304 rpmI, - NG0297 NG0307.1 NG0302 NG0306 rplT, - NG0298 hpaIIV,vsr, - NG0300 NG0307 bioD, - NG0309 NG0303 pheS, - NG0299 bioA, - NG0308 pheT, - NG0304 Type: tandem, Name:  - 15 rplT, - NG0298 hpaIIV,vsr, - NG0300 NG0307 bioD, - NG0309 NG0303 pheS, - NG0299 bioA, - NG0308 pheT, - NG0304 himA,ihfA, - NG0305 rpmI, - NG0297 NG0307.1 NG0302 NG0306 himA,ihfA, - NG0305
* Calculated from Protein Sequence

Gene ID: NG0304

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pheT  

Definition:
phenylalanyl-tRNA synthetase beta chain (phenylalanine--tRNA ligase beta chain)

Gene Start:
303223

Gene Stop:
305583

Gene Length:
2361

Molecular Weight*:
85983

pI*:
5.10

Net Charge*:
-18.21

EC:
6.1.1.20  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
Oklahoma ID: NGO.304

For the alpha chain sequenece, see NG0299 (pheS).

For other 'phe' genes, see NG1510 (pheA).

Blast Summary:  PSI-Blast Search
NG0304 is orthologously related to AJ391257, Neisseria meningitidis, a phenylalanine-tRNA-synthetase beta chain protein: residues 1-694 are 92% similar to residues 1-694 of NG0304.

Numerous significant hits to phenylalanyl-tRNA synthetase beta chain (phenylalanine--tRNA ligase beta-subunit) in gapped BLAST; e.g. residues 1-786 are 42% similar to gb|AAF94379.1| phenylalanyl-tRNA synthetase, beta chain of Vibrio cholerae, residues 1-767 are 43% similar to gb|AAG06127.1|AE004702_4 phenylalanyl-tRNA synthetase, beta subunit of Pseudomonas aeruginosa, residues 1-771 are 42% similar to 13431893 phenylalanyl-tRNA synthetase beta chain (phenylalanine--tRNA ligase beta chain) of Pasteurella multocida.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0072
COG name: Phenylalanyl-tRNA synthetase beta subunit
Functional Class:  J
The phylogenetic pattern of COG0072 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002547 (Putative tRNA binding domain) with a combined E-value of 7.5e-17.
    IPB002547A    56-70
    IPB002547B    104-121


ProDom Summary:  Protein Domain Search
Residues 1-142 are 35% similar to a (SYNTHETASE PHENYLALANYL-TRNA BETA) protein domain (PD009777) which is seen in SYFB_MYCTU.

Residues 147-250 are 34% similar to a (PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN) protein domain (PD217334) which is seen in SYFB_RICPR.

Residues 147-678 are 39% similar to a (SYNTHETASE PHENYLALANYL-TRNA AMINOACYL-TRNA BETA CHAIN) protein domain (PD003388) which is seen in SYFB_ECOLI.

Residues 690-786 are 41% similar to a (SYNTHETASE AMINOACYL-TRNA) protein domain (PD006935) which is seen in O67620_AQUAE.

Residues 46-146 are 58% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD002123) which is seen in SYFB_HAEIN.



Paralogs:  Local Blast Search


NG0304 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 45 to 147 (E-value = 3.5e-35) place NG0304 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)
Residues 152 to 296 (E-value = 2e-72) place NG0304 in the B3_4 family which is described as B3/4 domain (PF03483)
Residues 402 to 470 (E-value = 1.1e-27) place NG0304 in the B5 family which is described as tRNA synthetase B5 domain (PF03484)
Residues 694 to 786 (E-value = 7.1e-30) place NG0304 in the FDX-ACB family which is described as Ferredoxin-fold anticodon binding domain (PF03147)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
269  
337

PDB Hit:
pdb|1B70|1B70-B PHENYLALANYL TRNA SYNTHETASE COMPLEXED WITH 319.0 9e-88
pdb|1MKH|1MKH-A C-TERMINAL DOMAIN OF METHIONYL-TRNA SYNTHETASE 114.0 8e-26
pdb|1EUJ|1EUJ-A A NOVEL ANTI-TUMOR CYTOKINE CONTAINS A 100.0 8e-22
pdb|1E7Z|1E7Z-A CRYS

Gene Protein Sequence:
MQFSYSWLKTQANPDLSADKLEHLLTMAGLEVEEIDTAAPAFSGVVVAEV
KSVEKHPDADRLNVTQVDAGTGELVQIVCGAPNVKPGIKVPCSLPVAVLP
GNFKIKPTKMRGVPSNGMLCSTNELGLPDDGVDGLHILPEDAPVGTNIRE
YLDLDDMLFTLKITPNRADCLSVKGIAREVSALTQCAFTPVEIQTAPIGS
EKKQAVRIDAPADCGRFISRVIENVNAKAATPDWMKQRLERSGIRSISAL
VDIGNYVMLEIGQPMHVFDADKLSGSLIVRRAQNGETLACLNEKTVTLAD
NTLVVADEKGALSLAGLMGGAASAVSDGTQNIVLEAAWFEPEIIVGKSRQ
YGFGSDSSFRFERGVDYRLQADAIERATELVLQICGGAAGEMVEAQGKLP
EAKQVGLRLGRLKTVLGVDIPAEQVETILQHLGLQPEKTAEGFRITAPSF
RFDIEIEADLIEEIGRVYGYENIPDDYTSGRLKMSELPETRRPRFAVYNE
MAARGYREVISYAFVDEQWELDFAANAAPIRLQNPLAAQYAVMRSTLIGG
LVEILQNNLNRKQNRVRVFEIACVFGKGSDGRFVQNERIGGLWYGAAMPE
QWGEKTRNADFYDIKADVENLLKNKAVEFVKTGHPALHPGRAANIVSDGK
VIGFVGELHPKWLQKYDLPQAPLVFEIDMAAVLECGKTRYRAVSKFQPVR
RDLAFVMPEVMNHDDLLLVLKGAANKLVQEISVFDVYRGTGLPEGMKSVA
VKVILQDMENTLTDEAVEPLIGKLIGVATEAGARLRS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTCTCCTACTCATGGCTGAAAACCCAAGCCAATCCTGATCTTTC
TGCCGATAAACTGGAACATCTTTTGACCATGGCCGGTTTGGAAGTGGAAG
AAATCGATACTGCCGCCCCTGCTTTCAGTGGCGTGGTTGTTGCCGAAGTA
AAATCTGTTGAAAAACATCCTGATGCAGACCGTTTGAACGTTACTCAAGT
TGATGCCGGTACGGGCGAGTTGGTTCAGATTGTTTGTGGTGCGCCGAATG
TCAAGCCGGGCATTAAAGTGCCGTGTTCGTTGCCGGTTGCCGTTTTGCCG
GGCAATTTTAAAATTAAGCCGACTAAAATGCGCGGCGTACCATCAAACGG
TATGCTGTGTTCGACCAATGAACTGGGTTTGCCTGATGATGGTGTAGACG
GCCTGCACATTCTGCCTGAAGATGCGCCTGTCGGTACCAACATCCGCGAA
TACTTGGATTTGGACGATATGCTGTTTACGTTGAAAATTACGCCTAACCG
CGCTGATTGCTTGAGTGTTAAGGGCATTGCGCGTGAGGTTTCTGCGTTGA
CTCAATGTGCGTTTACGCCTGTTGAAATTCAGACGGCCCCTATCGGCAGT
GAGAAAAAACAGGCTGTCCGTATTGATGCACCGGCTGACTGCGGCCGTTT
TATCAGCCGCGTTATTGAAAATGTCAACGCGAAAGCGGCTACTCCTGATT
GGATGAAACAACGTTTGGAACGCAGCGGTATCCGCAGCATTTCCGCATTG
GTGGACATTGGCAACTATGTGATGCTGGAAATCGGTCAGCCTATGCATGT
TTTCGATGCTGATAAGCTGTCGGGCAGTTTGATTGTCCGCCGTGCTCAAA
ATGGCGAGACTTTGGCGTGTCTGAATGAGAAGACGGTTACTTTGGCTGAC
AATACACTGGTGGTCGCTGATGAAAAAGGTGCGTTGAGCTTGGCCGGCTT
GATGGGTGGCGCGGCGAGCGCGGTTTCAGACGGCACGCAAAATATCGTGC
TGGAAGCGGCTTGGTTTGAGCCCGAAATCATCGTCGGCAAATCGCGCCAA
TACGGTTTCGGTTCGGATTCGTCGTTCCGCTTCGAGCGCGGCGTGGATTA
CCGTTTGCAGGCGGATGCCATTGAACGCGCCACCGAATTGGTTTTGCAGA
TTTGCGGCGGTGCGGCAGGCGAGATGGTGGAAGCACAAGGTAAATTGCCC
GAAGCCAAGCAGGTCGGATTGCGTTTGGGTCGTCTGAAAACCGTGTTGGG
CGTGGACATTCCTGCCGAACAGGTGGAAACCATTTTGCAACACTTGGGTC
TGCAGCCTGAGAAAACGGCGGAAGGCTTCCGCATTACCGCGCCGAGCTTC
CGTTTCGACATCGAAATTGAGGCTGATTTGATTGAAGAAATCGGACGCGT
TTACGGCTATGAAAACATCCCCGACGATTACACGTCAGGCCGTCTGAAAA
TGTCGGAACTGCCCGAAACACGCCGTCCGCGTTTTGCCGTTTACAACGAA
ATGGCGGCGCGCGGCTACCGCGAAGTGATCAGCTATGCCTTCGTTGACGA
GCAGTGGGAACTCGATTTTGCCGCCAACGCCGCCCCCATCCGCCTGCAAA
ACCCGCTGGCGGCGCAATATGCCGTGATGCGTTCTACGTTGATTGGCGGC
TTAGTGGAAATTTTGCAAAACAACCTGAACCGCAAGCAAAACCGCGTGCG
CGTGTTTGAAATCGCCTGCGTGTTCGGCAAAGGTTCAGACGGCCGGTTTG
TCCAAAACGAACGCATCGGCGGTCTGTGGTACGGCGCGGCGATGCCCGAA
CAATGGGGTGAGAAAACGCGCAATGCGGATTTTTACGACATCAAGGCGGA
CGTGGAAAATCTGTTGAAAAACAAAGCGGTCGAGTTCGTTAAAACCGGAC
ATCCCGCCCTGCATCCCGGACGTGCCGCCAATATCGTTTCAGACGGCAAA
GTCATCGGCTTTGTCGGCGAACTGCATCCGAAATGGCTGCAAAAATACGA
CCTGCCGCAAGCGCCGCTGGTATTTGAAATCGATATGGCGGCTGTGTTGG
AATGCGGGAAAACGCGCTATCGGGCCGTATCGAAATTCCAGCCGGTGCGC
CGCGATTTGGCGTTTGTGATGCCGGAAGTTATGAATCATGATGATTTACT
GCTTGTCTTGAAAGGCGCAGCAAACAAGTTGGTACAGGAAATCAGCGTGT
TTGACGTGTATCGCGGCACGGGTCTGCCCGAAGGGATGAAGAGCGTGGCG
GTTAAAGTGATTTTGCAGGATATGGAAAACACGCTGACGGATGAGGCGGT
CGAGCCGCTTATTGGAAAACTGATTGGCGTGGCAACGGAGGCAGGGGCGC
GGCTTCGCAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy