Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-1 IGR0254 IGR0250 IGR0252 IGR0248 IGR0256 IGR0255 IGR0249 IGR0251 IGR0257 IGR0247 IGR0253 tgt,vacC, - NG0294 rpmI, - NG0297 NG0302 NG0306 rplT, - NG0298 hpaIIV,vsr, - NG0300 NG0307 infC, - NG0296 NG0303 pheS, - NG0299 thrS, - NG0295 pheT, - NG0304 tgt,vacC, - NG0294 rpmI, - NG0297 NG0302 NG0306 rplT, - NG0298 hpaIIV,vsr, - NG0300 NG0307 infC, - NG0296 NG0303 pheS, - NG0299 thrS, - NG0295 pheT, - NG0304 tgt,vacC, - NG0294 rplT, - NG0298 hpaIIV,vsr, - NG0300 infC, - NG0296 NG0303 pheS, - NG0299 thrS, - NG0295 pheT, - NG0304 himA,ihfA, - NG0305 NG0307 rpmI, - NG0297 NG0302 NG0306 himA,ihfA, - NG0305
* Calculated from Protein Sequence

Gene ID: NG0300

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hpaIIV  vsr  

Definition:
very short patch repair endonuclease

Gene Start:
301365

Gene Stop:
301775

Gene Length:
411

Molecular Weight*:
15985

pI*:
10.60

Net Charge*:
13.09

EC:
3.1.-.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Claus,H., Friedrich,A., Frosch,M. and Vogel,U. 2000. Differential distribution of novel restriction-modification systems in clonal lineages of Neisseria meningitidis. J. Bacteriol. 182 (5): 1296-1303. Medline: 20138154.


Secondary Evidence:
Roberts,R.J. 1990. Cloning and characterization of the HpaII methylase gene. Nucleic Acids Res. 18 (6): 1377-1383. Medline: 90221858.
Wilson,G.G. 1994. Organization and sequence of the HpaII restriction-modification system and adjacent genes. Gene 142 (1): 9-15. Medline: 94237495.

Comment:
Oklahoma ID: NGO.300

Blast Summary:  PSI-Blast Search
NG0300 is orthologously related to AJ238948, Neisseria meningitidis, a putative very short patch repair endonuclease protein: residues 1-137 are 88% similar to residues 1-137 of NG0300.

A few significant hits to patch repair proteins in gapped BLAST; e.g. residues 1-137 are 60% similar to gb|AAA20480.1| HpaII very-short-patch-repair endonuclease of Haemophilus parainfluenzae, residues 2-115 are 34% similar to 11387320 very-short-patch-repair endonuclease of Xanthomonas oryzae, residues 8-118 are 37% similar to 13425376 patch repair protein of Caulobacter crescentus.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-115 are 66% similar to a (REPAIR DNA ENDONUCLEASE HYDROLASE) protein domain (PD016088) which is seen in VSH2_HAEPA.



Paralogs:  Local Blast Search


NG0300 is paralogously related to NG1173 (DNA mismatch endonuclease, patch repair protein) (2e-22).


Pfam Summary:  Pfam Search
Residues 1 to 75 (E-value = 1.9e-50) place NG0300 in the Vsr family which is described as DNA mismatch endonuclease Vsr (PF03852)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1CW0|1CW0-A CRYSTAL STRUCTURE ANALYSIS OF VERY SHORT PATCH 67.1 1e-12
pdb|1VSR|1VSR-A VERY SHORT PATCH REPAIR (VSR) ENDONUCLEASE FROM 174.0 9e-45

Gene Protein Sequence:
MDKLTPEQRKKCMQSNKSTGTKPELVLAKAMWALGLRYRKNSGSIFGKPD
FSFKKYKVAVFVDGEFWHGKDWEQKKAVIKGNREFWIAKIERNIQRDIEV
TGRLKAEGWTVLRFWSNDVVKNTTCCAEKVKEIIQTR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAATTAACCCCGGAGCAGCGCAAAAAATGTATGCAGTCCAACAA
AAGTACAGGGACGAAACCCGAGCTTGTGTTGGCGAAGGCAATGTGGGCTT
TGGGGCTCAGGTATCGGAAAAATAGCGGAAGCATTTTTGGAAAACCTGAT
TTTTCATTTAAAAAATATAAAGTTGCCGTATTTGTCGATGGGGAATTCTG
GCACGGTAAGGATTGGGAACAGAAAAAAGCGGTAATAAAGGGAAATCGTG
AGTTTTGGATTGCCAAAATTGAGCGCAATATCCAAAGGGATATAGAAGTA
ACAGGCCGTCTGAAAGCCGAGGGCTGGACGGTTTTACGTTTTTGGAGTAA
CGATGTCGTCAAAAATACAACCTGCTGTGCCGAAAAAGTCAAAGAAATCA
TCCAAACAAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy