Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-1 IGR0254 IGR0250 IGR0252 IGR0248 IGR0256 IGR0255 IGR0249 IGR0251 IGR0247 IGR0253 tgt,vacC, - NG0294 rpmI, - NG0297 NG0302 himA,ihfA, - NG0305 rplT, - NG0298 hpaIIV,vsr, - NG0300 infC, - NG0296 NG0303 pheS, - NG0299 thrS, - NG0295 pheT, - NG0304 tgt,vacC, - NG0294 rpmI, - NG0297 NG0302 himA,ihfA, - NG0305 rplT, - NG0298 hpaIIV,vsr, - NG0300 infC, - NG0296 NG0303 pheS, - NG0299 thrS, - NG0295 pheT, - NG0304 tgt,vacC, - NG0294 himA,ihfA, - NG0305 rplT, - NG0298 hpaIIV,vsr, - NG0300 infC, - NG0296 NG0303 pheS, - NG0299 thrS, - NG0295 pheT, - NG0304 rpmI, - NG0297 NG0302
* Calculated from Protein Sequence

Gene ID: NG0299

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pheS  

Definition:
phenylalanyl-tRNA synthetase alpha chain (phenylalanine-tRNA ligase alpha chain)

Gene Start:
300293

Gene Stop:
301345

Gene Length:
1053

Molecular Weight*:
39414

pI*:
5.10

Net Charge*:
-10.90

EC:
6.1.1.20  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Mechulam,Y., Fayat,G. and Blanquet,S. 1985. Sequence of the Escherichia coli pheST operon and identification of the himA gene. J. Bacteriol. 163 (2): 787-791. Medline: 85261100.

Comment:
Oklahoma ID: NGO.299

For the beta chain sequence, see NG0304 (pheT). See NG1510 for pheA.

Blast Summary:  PSI-Blast Search
NG0299 is orthologously related to Q9JR76, Neisseria meningitidis, serogroup A, phenylalanyl-tRNA synthetase alpha chain (phenylalanine-tRNA ligase alpha chain): residues 1-328 are 99% similar to residues 23-350 of NG0299.

Numerous significant hits to phenylalanyl-tRNA synthetase alpha chain (phenylalanine-tRNA ligase alpha chain) in gapped BLAST; e.g. residues 23-351 are 59% similar to gb|AAF94378.1| phenylalanyl-tRNA synthetase, alpha chain of Vibrio cholerae, residues 23-351 are 59% similar to gb|AAC74784.1| phenylalanine tRNA synthetase, alpha-subunit of Escherichia coli K12.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0016
COG name: Phenylalanyl-tRNA synthetase alpha subunit
Functional Class:  J
The phylogenetic pattern of COG0016 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 112-350 are 61% similar to a (SYNTHETASE AMINOACYL-TRNA PHENYLALANYL-TRNA PROTEIN) protein domain (PD002080) which is seen in SYFA_ECOLI.



Paralogs:  Local Blast Search


NG0299 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 38 to 110 (E-value = 1.7e-38) place NG0299 in the Phe_tRNA-synt_N family which is described as Aminoacyl tRNA synthetase class II, N-terminal domain (PF02912)
Residues 130 to 337 (E-value = 4.8e-138) place NG0299 in the tRNA-synt_2d family which is described as tRNA synthetases class II core domain (F) (PF01409)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
82  
113

PDB Hit:
pdb|1B70|1B70-A PHENYLALANYL TRNA SYNTHETASE COMPLEXED WITH 247.0 2e-66
pdb|1B70|1B70-B PHENYLALANYL TRNA SYNTHETASE COMPLEXED WITH 42.2 1e-04
pdb|1B70|1B70-A PHENYLALANYL TRNA SYNTHETASE COMPLEXED WITH 424.0 0e+00
pdb|1B70|1B70-B PHEN

Gene Protein Sequence:
MSGYTGGLVVSGGISLIDRLDIMENVNRIVAEGIAAVEAAQDFNALEQIK
ARYLGKTGELTGLLKTLGQMSPEERKTIGAHINECKNRFQTAFNAKRDAL
NEAKLQARLAAEALDITLPGRAQEGGSLHPVTLTLQRVVELFHGMGFEVA
DGPEIEDDFHNFQALNIPANHPARAMQDTFYVENGDVLRTHTSPIQIRYM
LDKKEPPIRIIAPGRVYRVDSDATHSPMFHQAEGLWVEEGVTFADLKAVF
TDFIRRFFERDDLQVRFRPSFFPFTEPSAEIDIMGENGKWLEVGGCGMVH
PNVLKNVNIDPEKYTGFAFGIGLDRFAMLRYNVNDLRLFFDNDLNFLKQF
E

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGGCTATACAGGCGGCCTCGTTGTTTCAGGTGGCATATCATTAAT
TGACAGGCTTGATATTATGGAAAATGTAAACCGTATCGTTGCAGAAGGCA
TTGCCGCAGTAGAAGCTGCGCAAGACTTCAACGCTCTAGAACAAATCAAA
GCCCGTTATCTTGGCAAAACCGGCGAGTTGACCGGACTTCTGAAAACTTT
GGGGCAAATGTCGCCTGAAGAGCGCAAAACCATAGGTGCGCATATCAATG
AATGCAAAAACCGGTTTCAGACGGCTTTTAATGCCAAACGCGATGCCCTC
AACGAAGCCAAGCTGCAAGCCCGACTTGCCGCCGAAGCCCTCGACATTAC
CCTGCCCGGACGCGCTCAGGAAGGCGGCAGCCTGCATCCCGTAACCCTGA
CCTTGCAACGTGTGGTCGAACTCTTTCACGGAATGGGTTTCGAAGTGGCG
GACGGGCCTGAAATCGAAGACGATTTTCACAATTTCCAAGCCCTGAACAT
CCCTGCAAACCATCCTGCCCGTGCGATGCAGGATACGTTTTACGTTGAAA
ACGGCGATGTTTTGCGTACGCACACTTCCCCGATTCAAATCCGCTATATG
CTCGATAAAAAAGAGCCGCCCATCCGCATTATCGCCCCCGGCCGCGTTTA
CCGTGTGGACAGCGATGCCACGCACTCGCCTATGTTCCATCAGGCCGAGG
GTTTGTGGGTAGAAGAGGGCGTAACTTTTGCCGACTTAAAAGCAGTGTTC
ACTGACTTTATCCGTCGCTTCTTTGAACGCGATGACCTACAAGTGCGTTT
CCGTCCGTCTTTCTTCCCGTTTACCGAGCCTTCTGCCGAAATCGACATCA
TGGGAGAAAACGGCAAATGGTTGGAAGTAGGCGGTTGCGGTATGGTACAT
CCTAATGTGTTGAAAAATGTCAATATCGACCCTGAAAAATATACCGGTTT
CGCTTTCGGTATTGGTCTCGACCGCTTTGCCATGTTGCGCTACAACGTCA
ATGACCTGCGCTTGTTCTTCGATAACGATTTGAACTTCTTGAAGCAGTTT
GAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy