Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-1 IGR0244 IGR0254 IGR0250 IGR0252 IGR0248 IGR0246 IGR0249 IGR0251 IGR0245 IGR0247 IGR0253 NG0292 hemH, - NG0293 tgt,vacC, - NG0294 rpmI, - NG0297 NG0302 rplT, - NG0298 hpaIIV,vsr, - NG0300 infC, - NG0296 NG0303 pheS, - NG0299 NG0291 thrS, - NG0295 NG0292 hemH, - NG0293 tgt,vacC, - NG0294 rpmI, - NG0297 NG0302 rplT, - NG0298 hpaIIV,vsr, - NG0300 infC, - NG0296 NG0303 pheS, - NG0299 NG0291 thrS, - NG0295 NG0292 hemH, - NG0293 tgt,vacC, - NG0294 rplT, - NG0298 hpaIIV,vsr, - NG0300 infC, - NG0296 NG0303 pheS, - NG0299 NG0291 thrS, - NG0295 rpmI, - NG0297 NG0302
* Calculated from Protein Sequence

Gene ID: NG0295

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thrS  

Definition:
threonyl-tRNA synthetase (threonine--tRNA ligase)

Gene Start:
296950

Gene Stop:
298860

Gene Length:
1911

Molecular Weight*:
72718

pI*:
6.00

Net Charge*:
-11.58

EC:
6.1.1.3  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glycine, serine and threonine metabolism

Comment:
For other 'thr' genes see NG2075 (thrB) and NG0689 (thrC).

Oklahoma ID: NGO.295

Blast Summary:  PSI-Blast Search
NG0295 is orthologously related to AE002426, Neisseria meningitidis, strain MC58, a threonyl-tRNA synthetase protein: residues 1-637 are 98% similar to residues 1-637 of NG0295.

Numerous significant hits to threonyl-tRNA synthetase (threonine--tRNA ligase) in gapped BLAST; e.g. residues 4-631 are 68% similar to gb|AAG06132.1|AE004702_9 threonyl-tRNA synthetase of Pseudomonas aeruginosa, residues 1-629 are 65% similar to gb|AAF83546.1|AE003915_11 threonyl-tRNA synthetase of Xylella fastidiosa.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0441
COG name: Threonyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0441 is amtkYqVceBrhujgpoLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 518-630 are 59% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000606) which is seen in SYT_ECOLI.

Residues 208-242 are 74% similar to a (SYNTHETASE THREONYL-TRNA AMINOACYL-TRNA) protein domain (PD004144) which is seen in SYT_ECOLI.

Residues 68-207 are 58% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD001534) which is seen in SYT_HAEIN.

Residues 455-513 are 71% similar to a (SYNTHETASE AMINOACYL-TRNA THREONYL-TRNA LIGASE) protein domain (PD002782) which is seen in SYT_RICPR.

Residues 243-434 are 66% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000380) which is seen in SYT_ECOLI.

Residues 51-160 are 29% similar to a (PROTEIN ORF PUTATIVE KINASE) protein domain (PD000146) which is seen in SYT_BUCAP.



Paralogs:  Local Blast Search


NG0295 is paralogously related to NG0566 (prolyl-tRNA synthetase protein) (1e-10).


Pfam Summary:  Pfam Search
Residues 1 to 61 (E-value = 4.9e-08) place NG0295 in the TGS family which is described as TGS domain (PF02824)
Residues 261 to 414 (E-value = 1.7e-61) place NG0295 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 540 to 629 (E-value = 6.2e-24) place NG0295 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QF6|1QF6-A STRUCTURE OF E. COLI THREONYL-TRNA SYNTHETASE 781.0 0.000000
pdb|1EVK|1EVK-A CRYSTAL STRUCTURE OF A TRUNCATED FORM OF 526.0 0e+00
pdb|1H4Q|1H4Q-A PROLYL-TRNA SYNTHETASE FROM THERMUS THERMOPHILUS 74.9 4e-14
pdb|1QF6|1QF6-A ST

Gene Protein Sequence:
MLNITLPDCSVRQYESPVTVAQIAASIGAGLAKAAVAGKVNGKLVDACDP
IVEDSAVQIITPKDQEGIEIIRHSCAHLVGHAVKQLYPNAKMVIGPVIEE
GFYYDIATEKPFTPEDVAAIEARMKELIAQDYDVVKIMTPRAEAIKIFQE
RGEEYKLRLIDDMPEVEAMGIYHHQEYVDMCRGPHVPNTRFLKNFKLTKL
AGAYWRGDSNNEMLQRIYGTAWATKDELKDYIQRIEEAEKRDHRKLGKQL
DLFHLQDEAPGMVFWHPKGWALWQTIEQHMRKELNAAGYKEVKTPQIMDK
TFWEKSGHWDNYKDNMFVTSSEKREYAVKPMNCPGHVQIFNNGLRSYRDL
PMRLAEFGSCHRNEPSGALHGLMRVRGFVQDDAHIFCTEDQIVSEARAFN
ELLVRIYKQFGFHDVSVRLSLRPEKRAGSDDVWDKAEQGLREALTACGVE
WGELPGEGAFYGPKIEYHVKDALGRSWQCGTLQLDFVLPERLDAEYVTEN
NDRARPVMLHRAILGSLERFIGILIENHAGSFPLWLAPVQMVIMNITENQ
ADYCREVAAKLQAAGFRAELDLRNEKIGYKIRDNSQYRFPYQIVIGDKEK
QENKVAVRRKAEDLGSLDLDDFIAQLQQEITDALVNH

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAATATTACCTTGCCGGACTGTTCAGTCCGCCAATACGAATCCCC
CGTTACCGTGGCTCAAATTGCTGCGTCTATCGGTGCCGGTTTGGCGAAGG
CGGCGGTGGCAGGCAAGGTAAACGGCAAATTGGTCGATGCGTGCGACCCG
ATTGTTGAGGATTCTGCTGTTCAAATCATTACTCCGAAAGATCAGGAAGG
CATCGAAATCATCCGCCATTCCTGCGCACATCTTGTCGGGCATGCCGTCA
AGCAACTCTATCCTAATGCAAAAATGGTTATCGGCCCCGTCATTGAAGAG
GGCTTTTATTACGACATCGCCACGGAAAAACCGTTTACACCGGAAGATGT
TGCCGCCATTGAAGCGCGTATGAAAGAATTGATTGCCCAAGATTATGATG
TGGTCAAAATCATGACTCCGCGTGCGGAGGCGATTAAAATTTTTCAAGAG
CGCGGCGAAGAATACAAACTGCGCCTGATTGACGATATGCCCGAAGTGGA
AGCGATGGGGATATATCATCACCAGGAATATGTCGATATGTGCCGCGGTC
CGCACGTTCCGAACACCCGCTTCCTGAAAAACTTCAAGCTGACCAAGCTG
GCAGGCGCATATTGGCGCGGCGACAGCAATAATGAAATGCTGCAACGTAT
TTATGGCACTGCTTGGGCGACGAAAGACGAATTAAAAGACTATATCCAAC
GCATTGAAGAAGCAGAAAAACGTGACCACCGCAAATTGGGCAAGCAACTG
GATTTGTTCCACTTGCAGGACGAAGCGCCGGGTATGGTGTTTTGGCATCC
CAAAGGTTGGGCTTTGTGGCAGACTATCGAGCAGCATATGCGTAAAGAGC
TGAACGCCGCCGGTTATAAAGAGGTCAAAACGCCTCAAATTATGGATAAA
ACCTTTTGGGAAAAATCCGGCCACTGGGACAACTACAAAGACAATATGTT
CGTAACCAGTTCGGAAAAACGCGAATATGCGGTTAAACCGATGAACTGTC
CGGGTCATGTTCAAATTTTCAACAACGGTTTGCGTTCATATCGAGATTTG
CCGATGCGTTTGGCGGAATTCGGTTCTTGCCACCGCAACGAGCCGAGCGG
CGCACTGCACGGTCTGATGAGGGTTCGCGGTTTTGTGCAGGATGATGCGC
ATATTTTTTGTACCGAAGATCAAATCGTCAGCGAGGCTCGTGCGTTCAAT
GAATTGTTGGTTCGCATCTACAAACAGTTCGGTTTCCATGATGTATCCGT
CAGGCTTTCCCTTCGCCCTGAAAAACGCGCAGGTTCAGACGACGTGTGGG
ATAAGGCAGAGCAGGGTTTGCGCGAGGCATTGACTGCCTGCGGCGTGGAA
TGGGGCGAATTGCCGGGCGAGGGTGCGTTTTACGGGCCTAAAATCGAATA
TCACGTCAAAGATGCCTTGGGTCGTTCTTGGCAATGCGGTACATTACAAC
TGGATTTTGTCTTGCCGGAACGCTTGGATGCAGAATATGTAACAGAAAAC
AACGACCGAGCGCGGCCTGTTATGTTGCATCGCGCCATTTTAGGTTCTTT
GGAGCGGTTTATCGGCATTCTGATTGAGAACCATGCAGGCTCTTTCCCGT
TATGGCTTGCACCGGTTCAAATGGTGATTATGAACATCACCGAAAATCAG
GCAGATTATTGTCGGGAAGTTGCTGCCAAATTGCAGGCGGCAGGCTTCCG
CGCCGAGTTGGATTTGCGTAATGAAAAAATCGGTTACAAAATCCGCGACA
ACAGCCAATACCGTTTCCCTTATCAAATCGTTATCGGTGATAAAGAGAAA
CAAGAAAACAAAGTTGCGGTACGCCGCAAAGCGGAAGACTTGGGTTCTTT
GGATTTGGATGATTTCATTGCGCAATTGCAGCAAGAAATCACTGATGCCC
TCGTCAATCAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy