Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-1 IGR0244 IGR0250 IGR0248 IGR0242 IGR0246 IGR0249 IGR0251 IGR0245 IGR0243 IGR0247 NG0292 NG0290 hemH, - NG0293 tgt,vacC, - NG0294 rpmI, - NG0297 rplT, - NG0298 infC, - NG0296 pheS, - NG0299 NG0291 thrS, - NG0295 NG0292 NG0290 hemH, - NG0293 tgt,vacC, - NG0294 rpmI, - NG0297 rplT, - NG0298 infC, - NG0296 pheS, - NG0299 NG0291 thrS, - NG0295 NG0292 NG0290 hemH, - NG0293 tgt,vacC, - NG0294 rplT, - NG0298 infC, - NG0296 pheS, - NG0299 NG0291 thrS, - NG0295 rpmI, - NG0297
* Calculated from Protein Sequence

Gene ID: NG0294

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tgt  vacC  

Definition:
queuine tRNA-ribosyltransferase (tRNA-guanine transglycosylase) (guanine insertion enzyme) (virulence-associated protein VacC)

Gene Start:
296642

Gene Stop:
295530

Gene Length:
1113

Molecular Weight*:
41951

pI*:
7.20

Net Charge*:
1.35

EC:
2.4.2.29  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Durand,J.M., Okada,N., Tobe,T., Watarai,M., Fukuda,I., Suzuki,T.,
Nakata,N., Komatsu,K., Yoshikawa,M. and Sasakawa,C. 1994. vacC, a virulence-associated chromosomal locus of Shigella flexneri, is homologous to tgt, a gene encoding tRNA-guanine transglycosylase (Tgt) of Escherichia coli K-12. J. Bacteriol. 176 (15): 4627-4634. Medline: 94321334.


Comment:
For other 'vac'genes see NG2121 ( vacJ ).

Oklahoma ID: NGO.294c

Blast Summary:  PSI-Blast Search
NG0294 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative queuine tRNA-ribosyltransferase protein: residues 1-371 are 96% similar to residues 1-371 of NG0294.

Numerous significant hits to queuine tRNA-ribosyltransferase (tRNA-guanine transglycosylase) (guanine insertion enzyme) (virulence-associated protein VacC) in gapped BLAST; e.g. residues 2-370 are 60% similar to gb|AAF93906.1| queuine tRNA-ribosyltransferase of Vibrio cholerae, residues 2-370 are 59% similar to 2498994 queuine tRNA-ribosyltransferase (tRNA-guanine transglycosylase) (guanine insertion enzyme) virulence-associated protein VacC) of Shigella flexneri, residues 2-370 are 59% similar to gb|AAG54753.1|AE005220_2
tRNA-guanine transglycosylase of Escherichia coli O157:H7 EDL933.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0343
COG name: Queuine/archaeosine tRNA-ribosyltransferase
Functional Class:  J
The phylogenetic pattern of COG0343 is AmTk-qvceb-huj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002616 (Queuine tRNA-ribosyltransferase) with a combined E-value of 1.1e-130.
    IPB002616A    25-35
    IPB002616B    58-99
    IPB002616C    123-148
    IPB002616D    183-215
    IPB002616E    236-276
    IPB002616F    303-319


ProDom Summary:  Protein Domain Search
Residues 126-362 are 59% similar to a (TRANSFERASE QUEUINE) protein domain (PD004261) which is seen in TGT_ECOLI.

Residues 1-99 are 67% similar to a (TRANSFERASE QUEUINE) protein domain (PD004830) which is seen in O67331_AQUAE.



Paralogs:  Local Blast Search


NG0294 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 126 to 364 (E-value = 3.8e-122) place NG0294 in the TGT family which is described as Queuine tRNA-ribosyltransferase (PF01702)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1ENU|1ENU-A A NEW TARGET FOR SHIGELLOSIS: RATIONAL DESIGN 404.0 0e+00
pdb|1EFZ|1EFZ-A MUTAGENESIS AND CRYSTALLOGRAPHIC STUDIES OF 402.0 0e+00
pdb|1WKE|1WKE TRNA-GUANINE TRANSGLYCOSYLASE 400.0 0e+00
pdb|1WKD|1WKD TRNA-

Gene Protein Sequence:
MLKFTLHKKDGLARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQNLHDI
KAQIILGNTYHLWLRPGLEVVEQFGGLHGFIGWDKPILTDSGGFQVFSLS
DMRKLTEEGCTFKSPINGDKLFLSPEISMKIQTVLNSDIAMQLDECTPGE
TTREQARKSLQMSLRWAERSKKAFEDLKNPNALFGIVQGAMYEDLREESL
RGLEEFDFPGLAVGGLSVGEPKPEMYRMLHAVGPMLPERKPHYLMGVGTP
EDLVYGVAHGIDMFDCVMPTRNARNGWLFTRFGDLKIKNAKHKPDKRPID
ESCTCYACQNFSRAYLHHLHRAGEILGAQLNTIHNLHFYQVIMAEMRDAV
EQGKFADWQAQFHENRARGVD

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAAATTTACTTTACACAAAAAAGACGGTCTCGCCCGACGCGGCAC
GCTGGAGTTGAACCACGGAAAAATCGAAACGCCGGTTTTCATGCCGGTCG
GTACTTACGGTTCGGTCAAAGCGATGAACCCGCAAAACCTGCACGACATC
AAGGCGCAAATTATTTTGGGCAACACTTATCATTTGTGGCTGCGTCCGGG
TTTGGAGGTCGTCGAACAGTTTGGAGGGCTTCACGGTTTTATCGGCTGGG
ACAAACCGATTCTGACCGACTCGGGCGGTTTTCAGGTTTTTTCTTTGTCG
GATATGCGCAAGCTGACCGAAGAAGGCTGTACGTTTAAAAGCCCGATTAA
CGGCGACAAGCTGTTTTTATCACCTGAAATTTCCATGAAAATCCAAACGG
TTTTGAACTCGGATATCGCGATGCAGTTGGACGAATGCACGCCGGGCGAA
ACAACGCGCGAACAGGCGCGAAAATCCCTGCAAATGAGCTTGCGCTGGGC
GGAACGGAGCAAAAAAGCCTTTGAAGATTTGAAAAACCCGAACGCGCTGT
TCGGCATCGTGCAAGGCGCGATGTATGAGGATTTGCGCGAAGAATCTTTG
CGCGGTTTGGAGGAATTTGATTTTCCCGGCCTTGCCGTCGGCGGTTTGTC
CGTCGGCGAACCCAAGCCCGAAATGTACCGTATGCTGCACGCCGTCGGCC
CGATGCTGCCCGAACGCAAACCGCATTACCTGATGGGCGTAGGCACGCCG
GAAGACCTCGTGTACGGCGTGGCGCACGGCATCGATATGTTCGACTGCGT
GATGCCCACCCGCAATGCACGCAACGGCTGGCTGTTTACCCGTTTCGGCG
ATTTGAAAATCAAAAACGCCAAACACAAGCCCGACAAGCGTCCGATAGAC
GAAAGCTGCACCTGCTACGCCTGCCAAAATTTCAGCCGCGCCTACCTGCA
CCATCTGCACCGCGCCGGCGAAATCTTGGGCGCGCAATTGAACACCATCC
ACAACCTGCATTTCTACCAAGTCATCATGGCGGAAATGCGCGATGCCGTC
GAACAAGGCAAATTTGCCGACTGGCAGGCGCAATTCCACGAAAACCGCGC
GCGCGGCGTGGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy