Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Val-1 IGR0244 IGR0250 IGR0248 IGR0242 IGR0246 IGR0249 IGR0245 IGR0243 IGR0247 NG0292 NG0290 hemH, - NG0293 tgt,vacC, - NG0294 lnt, - NG0289 rpmI, - NG0297 rplT, - NG0298 infC, - NG0296 NG0291 thrS, - NG0295 NG0292 NG0290 hemH, - NG0293 tgt,vacC, - NG0294 lnt, - NG0289 rpmI, - NG0297 rplT, - NG0298 infC, - NG0296 NG0291 thrS, - NG0295 NG0292 NG0290 hemH, - NG0293 tgt,vacC, - NG0294 lnt, - NG0289 rplT, - NG0298 infC, - NG0296 NG0291 thrS, - NG0295 rpmI, - NG0297
* Calculated from Protein Sequence

Gene ID: NG0293

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemH  

Definition:
ferrochelatase (protoheme ferro-lyase) (heme synthetase)

Gene Start:
295445

Gene Stop:
294438

Gene Length:
1008

Molecular Weight*:
38048

pI*:
6.50

Net Charge*:
-2.29

EC:
4.99.1.1  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Schlor S, Herbert M, Rodenburg M, Blass J, Reidl J.
Characterization of ferrochelatase (hemH) mutations in Haemophilus influenzae.
Infect Immun. 2000 May;68(5):3007-9.
PMID: 10769004

Comment:
Oklahoma ID: NGO.293c

For other 'hem' genes, see NG0234 and NG1580 (hemN), NG0040 (hemL), NG0360 (hemX), NG0362 (hemE), NG0385 (hemB), NG1318 (hemO), NG1403 (hemA), NG2015 (hemK).

Blast Summary:  PSI-Blast Search
NG0293 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative ferrochelatase protein: residues 1-336 are 95% similar to residues 1-336 of NG0293.

Numerous significant hits to ferrochelatase (protoheme ferro-lyase) (heme synthetase) in gapped BLAST; e.g. residues 14-332 are 44% similar to 13124750 ferrochelatase (protoheme ferro-lyase) (heme synthetase) of Yersinia enterocolitica, residues 18-332 are 45% similar to gb|AAF83376.1|AE003903_12 ferrochelatase of Xylella fastidiosa, residues 17-329 are 42% similar to gb|AAF94148.1| ferrochelatase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0276
COG name: Protoheme ferro-lyase (ferrochelatase)
Functional Class:  H
The phylogenetic pattern of COG0276 is ----yq-cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001015 (Ferrochelatase) with a combined E-value of 2.2e-63.
    IPB001015A    19-29
    IPB001015B    82-88
    IPB001015C    119-151
    IPB001015D    201-214
    IPB001015E    216-235
    IPB001015F    245-261
    IPB001015G    270-304


ProDom Summary:  Protein Domain Search
Residues 14-317 are 44% similar to a (FERROCHELATASE HEME BIOSYNTHESIS LYASE) protein domain (PD002792) which is seen in HEMZ_YEREN.



Paralogs:  Local Blast Search


NG0293 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 17 to 332 (E-value = 9.4e-112) place NG0293 in the Ferrochelatase family which is described as Ferrochelatase (PF00762)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1HRK|1HRK-A CRYSTAL STRUCTURE OF HUMAN FERROCHELATASE 87.4 4e-18
pdb|1C9E|1C9E-A STRUCTURE OF FERROCHELATASE WITH COPPER(II) N- 69.5 9e-13
pdb|1DOZ|1DOZ-A CRYSTAL STRUCTURE OF FERROCHELATASE 69.5 9e-13
pdb|1AK1|1AK1 FERRO

Gene Protein Sequence:
MLPFLPEPSLSYTQQNRTAVLLLNLGTPDAPTAQAVRPYLKSFLTDRRIV
ELPKWLWYPILHGLVLTFRPKKSAHAYEKIWFKEGSPLEVYTARQAAALA
ERMPDLIVRHAMTYGNPSIADVLAELKSQGVGRLLAIPLYPQYAASSSGA
AVDKVCEQLLLQRNQMSVRTISRFYDDAGYIDAMKNHILRYWAEHGRGKK
LMLSFHGVPQKHYDLGDPYPDECRHTAKLLAEALELTEDEYTVSFQSQFG
RAKWVTPSTQDLFGKLPKQGVTELDVFCPGFLADCLETMEEIALMGREQF
YEAGGKNYRYIPCLNDNPDWIDALVALAEENLGGWR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTCCATTCCTTCCAGAACCCTCCCTTTCCTATACGCAACAAAACCG
TACCGCCGTTTTGCTGTTGAACCTCGGCACACCCGACGCACCGACCGCAC
AGGCGGTACGCCCTTATCTGAAATCCTTTCTGACCGACCGGCGCATCGTC
GAACTGCCCAAATGGCTGTGGTATCCCATTCTGCATGGCCTGGTACTGAC
GTTCCGCCCCAAAAAAAGCGCGCACGCCTATGAAAAAATCTGGTTTAAGG
AAGGTTCGCCCCTAGAAGTTTACACAGCACGCCAAGCTGCCGCGCTTGCC
GAACGTATGCCCGACCTCATCGTCCGCCACGCCATGACTTACGGCAATCC
TTCGATAGCGGATGTATTGGCGGAGCTGAAATCCCAAGGTGTAGGCAGAT
TGCTTGCGATTCCCCTGTATCCGCAATATGCCGCTTCCAGCAGCGGAGCG
GCGGTAGATAAAGTGTGCGAACAACTGCTGCTGCAACGCAACCAAATGAG
CGTCCGCACCATTTCGCGCTTTTATGATGATGCCGGCTACATTGATGCGA
TGAAAAACCACATCCTCCGATATTGGGCGGAACACGGGCGTGGGAAAAAA
CTGATGTTGAGTTTTCACGGCGTACCGCAGAAGCACTACGACCTCGGCGA
CCCCTATCCCGACGAGTGCCGCCACACCGCCAAACTGCTTGCCGAAGCAC
TGGAACTGACCGAAGACGAATATACCGTATCGTTCCAAAGCCAATTCGGC
AGGGCAAAATGGGTTACACCGAGCACGCAGGATTTGTTCGGCAAACTGCC
CAAACAGGGGGTAACCGAGCTGGACGTATTCTGCCCGGGCTTTTTGGCAG
ACTGCTTGGAAACCATGGAAGAAATCGCCCTGATGGGGCGGGAACAGTTT
TATGAAGCGGGCGGAAAAAACTACCGCTACATCCCCTGCCTCAACGACAA
CCCCGACTGGATAGACGCACTCGTCGCACTTGCCGAAGAAAACCTTGGCG
GCTGGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy