Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0244 IGR0238 IGR0242 IGR0239 IGR0240 IGR0237 IGR0240.1 IGR0245 IGR0243 IGR0241 NG0292 NG0290 rpoH, - NG0288 NG0286 hemH, - NG0293 lnt, - NG0289 NG0284 NG0287 NG0285 holA, - NG0283 NG0291 NG0292 NG0290 rpoH, - NG0288 NG0286 hemH, - NG0293 lnt, - NG0289 NG0284 NG0287 NG0285 holA, - NG0283 NG0291 NG0292 NG0290 rpoH, - NG0288 NG0286 hemH, - NG0293 lnt, - NG0289 NG0287 NG0285 holA, - NG0283 NG0291 NG0284
* Calculated from Protein Sequence

Gene ID: NG0289

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lnt  

Definition:
apolipoprotein N-acyltransferase

Gene Start:
291045

Gene Stop:
289510

Gene Length:
1536

Molecular Weight*:
56973

pI*:
9.00

Net Charge*:
5.08

EC:
2.3.1.-  

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Glycerolipid metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
Dailey FE, Macnab RM.
Effects of lipoprotein biogenesis mutations on flagellar assembly in Salmonella.
J Bacteriol. 2002 Feb;184(3):771-6.
PMID: 11790747

Sankaran K, Gupta SD, Wu HC.
Modification of bacterial lipoproteins.
Methods Enzymol. 1995;250:683-97. No abstract available.
PMID: 7651187

Sankaran K, Wu HC.
Lipid modification of bacterial prolipoprotein. Transfer of diacylglyceryl moiety from phosphatidylglycerol.
J Biol Chem. 1994 Aug 5;269(31):19701-6.
PMID: 8051048

Gupta,S.D., Gan,K., Schmid,M.B. and Wu,H.C.
Characterization of a temperature-sensitive mutant of Salmonella
typhimurium defective in apolipoprotein N-acyltransferase
J. Biol. Chem. 268 (22), 16551-16556 (1993)
MEDLINE: 93346404



Rogers,S.D., Bhave,M.R., Mercer,J.F., Camakaris,J. and Lee,B.T. 1991.
Cloning and characterization of cutE, a gene involved in copper transport in Escherichia coli.
J. Bacteriol. 173 (21): 6742-6748.
Medline: 92041555.


Comment:
Oklahoma ID: NGO.289c

Blast Summary:  PSI-Blast Search
NG0289 is orthologously related to AE002426, Neisseria
meningitidis, strain MC58, a putative apolipoprotein N-acyltransferase: residues 13-524 are 96% similar to residues 1-512 of NG0289.

Numerous significant hits to apolipoprotein n-acyltransferase (alp n-acyltransferase) (copper homeostasis protein cutE) in gapped BLAST; e.g. residues 17-490 are 34% similar to gb|AAF94120.1| apolipoprotein N-acyltransferase of Vibrio cholerae, residues 18-504 are 32% similar to 4191605 apolipoprotein N-acyltransferase of Salmonella typhimurium, residues 18-504 are 31% similar to dbj|BAB34118.1| apolipoprotein N-acyltransferase of Escherichia coli O157:H7.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0815
COG name: Apolipoprotein N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG0815 is -----qvce-Rhuj--oLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 362-462 are 43% similar to a (APOLIPOPROTEIN N-ACYLTRANSFERASE) protein domain (PD104099) which is seen in LNT_PSEAE.

Residues 53-346 are 28% similar to a (APOLIPOPROTEIN N-ACYLTRANSFERASE) protein domain (PD007694) which is seen in O87576_SALTY.



Paralogs:  Local Blast Search


NG0289 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 229 to 413 (E-value = 3.3e-47) place NG0289 in the CN_hydrolase family which is described as Carbon-nitrogen hydrolase (PF00795)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
162
cleavable N-terminal sequence  
1  
31
transmembrane  
36  
52
transmembrane  
94  
110
transmembrane  
173  
189
transmembrane  
199  
215
transmembrane  
491  
507

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MFSKLDKYWQHPALYWPLLILFAAATPFAFAPYYHFWLMPLIFGAFVRLI
ELRPRFAASSAYLFGLTAYTAQFYWIHTALHDVSGLPDLYAVPLTFLLPA
YLALYPALCFWLWKKFTLPQGIKTGLVLPILWTLTEFARERFLTGFGWGA
IGYSQITPDSPLAGFAPLGGIHMVTLATAFLGVWLVLAIDNTARSGKRLL
PAILIAALLAAGYTAQQTDFTRPDGSRSTVALLQGNIAQTLKWREDQVIP
TIQKYYEQVGKTTADIVILPETAIPIMRQNLPENILAQFAEQAQNNGSAL
AVGISQYTSDGNGYENAVINLTGYQENNQDGIPYYAKNHLVPFGEYKPLP
LLTTPLYKMMDMPLSDFRKGGGKQSAMMMKNQKIAFNICYEDGFGDELIA
AAKDATLLANVSNMAWYGKSNAMYQHLQQSQARAMELGRYMVRATNTGAT
AIISPKGNIIAQAQPDTETVLEGHIKGYIGETPYMKTGSSWWLMGILTLA
ALILFIFRNKEH

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCCAAACTGGACAAATACTGGCAGCACCCCGCCCTCTACTGGCC
TTTGCTCATCCTTTTTGCCGCCGCCACCCCCTTCGCCTTCGCACCCTACT
ACCACTTTTGGCTGATGCCCTTGATTTTCGGCGCCTTCGTCCGCCTCATC
GAACTGCGTCCGCGTTTTGCCGCCTCTTCCGCCTACCTGTTCGGTCTGAC
CGCATACACGGCACAGTTCTACTGGATACACACTGCCCTGCACGACGTTT
CCGGCCTGCCCGACCTCTATGCCGTACCGCTGACCTTCCTGCTGCCCGCC
TACCTTGCCCTTTATCCGGCACTGTGTTTCTGGCTGTGGAAAAAATTTAC
CCTGCCCCAGGGCATAAAGACCGGTCTGGTACTGCCCATCCTGTGGACGC
TGACCGAGTTTGCCCGCGAGCGTTTCCTGACCGGATTCGGCTGGGGCGCA
ATCGGCTACTCCCAAATCACCCCGGACAGCCCGCTGGCGGGTTTCGCCCC
CTTGGGCGGCATCCACATGGTTACACTGGCAACCGCCTTTCTCGGTGTCT
GGCTGGTTTTGGCGATCGACAACACCGCACGTTCGGGCAAACGCCTGCTT
CCGGCCATTCTGATTGCCGCCCTGCTTGCCGCAGGCTACACCGCCCAACA
AACCGACTTCACCCGCCCCGACGGCAGCCGCAGCACCGTCGCCCTGCTTC
AGGGCAACATCGCCCAAACCCTCAAATGGCGTGAAGACCAAGTCATCCCG
ACCATACAGAAATATTACGAACAGGTCGGCAAAACCACTGCCGACATCGT
CATCCTGCCCGAAACCGCCATTCCCATCATGCGCCAAAACCTGCCGGAAA
ACATACTGGCGCAATTCGCCGAACAGGCGCAAAACAACGGCAGCGCGCTC
GCCGTCGGCATCAGCCAATACACTTCGGACGGCAACGGTTACGAAAACGC
CGTCATCAACCTGACCGGCTATCAGGAAAACAATCAGGACGGCATCCCTT
ACTACGCCAAAAACCACCTCGTCCCCTTCGGCGAATACAAACCGCTGCCC
CTCCTGACCACACCGCTTTACAAAATGATGGACATGCCCCTTTCCGACTT
CCGCAAAGGCGGCGGCAAGCAATCCGCCATGATGATGAAAAACCAAAAAA
TCGCCTTCAACATCTGCTACGAAGACGGATTCGGCGACGAACTGATTGCC
GCCGCCAAAGACGCCACACTGCTTGCCAATGTCAGCAATATGGCGTGGTA
TGGAAAATCCAACGCCATGTACCAGCACCTCCAACAATCGCAGGCGCGGG
CTATGGAACTCGGACGCTATATGGTCCGCGCCACCAACACCGGCGCAACC
GCCATCATCTCCCCCAAAGGCAACATCATCGCCCAAGCCCAACCCGATAC
GGAAACCGTATTAGAAGGACACATCAAAGGCTACATCGGCGAAACGCCCT
ATATGAAAACCGGCAGTTCATGGTGGTTGATGGGCATATTGACCCTAGCC
GCACTGATTCTTTTCATCTTCCGAAACAAAGAACAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy