Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0236 IGR0238 IGR0235 IGR0234 IGR0232 IGR0237 IGR0233 IGR0233.1 IGR0231 NG0280 comL, - NG0277 NG0279 iga, - NG0275 NG0284 NG0282 NG0285 NG0281 holA, - NG0283 rluD, - NG0278 comA, - NG0276 NG0280 comL, - NG0277 NG0279 iga, - NG0275 NG0284 NG0282 NG0285 NG0281 holA, - NG0283 rluD, - NG0278 comA, - NG0276 NG0280 comL, - NG0277 NG0279 iga, - NG0275 NG0282 NG0285 NG0281 holA, - NG0283 rluD, - NG0278 comA, - NG0276 NG0284
* Calculated from Protein Sequence

Gene ID: NG0278

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rluD  

Definition:
ribosomal large subunit pseudouridine synthase D (probable ftsH suppressor protein SfhB)

Gene Start:
280552

Gene Stop:
281673

Gene Length:
1122

Molecular Weight*:
41283

pI*:
5.10

Net Charge*:
-15.03

EC:
4.2.1.70  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Pyrimidine metabolism

Comment:
Oklahoma ID: NGO.278

For other 'rlu' genes see NG1783 (rluC)

For related genes, see NG0607 (rsuA), NG0642, NG0433, NG0389, NG0657, NG1811.

Blast Summary:  PSI-Blast Search
NG0278 is orthologously related to AE002425, Neisseria meningitidis, strain MC58, a ribosomal large subunit pseudouridine synthase D protein: residues 1-374 are 97% similar to residues 1-374 of NG0278.

Numerous significant hits in gapped BLAST; e.g. residues 32-333 are 49% similar to gb|AAG07932.1|AE004868_3 pseudouridine synthase of Pseudomonas aeruginosa, residues 31-335 are 50% similar to 13362928 suppressor of ftsH mutation of Escherichia coli O157:H7.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0564
COG name: Predicted pseudouridylate synthase family 2
Functional Class:  J
The phylogenetic pattern of COG0564 is ----YqVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000613 (Pseudouridine synthase) with a combined E-value of 9.2e-65.
    IPB000613A    107-127
    IPB000613B    156-195
    IPB000613C    252-276
    IPB000613D    296-309
***** IPB002990 (Pseudouridine synthase, Rlu family) with a combined E-value of 7.9e-55.
    IPB002990A    107-127
    IPB002990B    156-194
    IPB002990C    252-276


ProDom Summary:  Protein Domain Search
Residues 31-87 are 48% similar to a (PROTEIN PSEUDOURIDINE SYNTHASE SFHB) protein domain (PD013642) which is seen in RLUD_ECOLI.

Residues 105-332 are 48% similar to a (PROTEIN PSEUDOURIDINE SYNTHASE RIBOSOMAL) protein domain (PD001819) which is seen in RLUD_HAEIN.



Paralogs:  Local Blast Search


NG0278 is paralogously related to NG1783 (pseudouridylate synthase) (6e-32), NG0433 (conserved hypothetical protein (probable pseudouridine synthase)) (2e-14) and NG1180 (conserved hypothetical protein) (3e-08).


Pfam Summary:  Pfam Search
Residues 39 to 85 (E-value = 1.1e-05) place NG0278 in the S4 family which is described as S4 domain (PF01479)
Residues 113 to 264 (E-value = 3.6e-67) place NG0278 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MQNTSFDNESDYSDDSDFASASGTENRIGLTVPLELAGGRLDAVLAKLLP
DYSRSRLTSWIKEGAVIVNDKPSQPKDKMIGGEQICVTVRPSEENLAFVP
EPMDLDIVYEDDTVIVVNKPAGLVVHPAAGNWTGTLLNGLLAHCPELSQI
PRAGIVHRLDKETSGLMVVAKTLPAQNSLVRQLQERTVKRIYRAVANGIV
PFDGKIETQIGRDPHNRLKMAAVKFGGKPAVTHVKVLERYLAHSYIECSL
GTGRTHQIRVHMREANHPLAGDPVYGNPRHPCGDTVKEAVKSLGARQALH
AYRLSFTHPESGETVSFEAPIPDDIYHLLSVLRLEAGLDSSLSNEEEWQD
KFGADDDDDWNEDDYDVEVVYVRE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGAATACTTCCTTTGATAATGAATCCGATTATAGCGACGATTCAGA
CTTTGCGTCAGCTTCCGGAACTGAAAACCGTATCGGTCTGACCGTTCCGC
TCGAGCTTGCCGGCGGGCGGTTGGATGCGGTGTTGGCGAAACTTCTGCCC
GACTATTCGCGCAGCCGCCTGACATCATGGATTAAAGAAGGCGCGGTTAT
TGTAAACGATAAACCTTCGCAACCCAAAGACAAAATGATAGGCGGCGAGC
AAATTTGTGTAACCGTCCGTCCGAGTGAGGAAAATCTGGCGTTTGTTCCG
GAGCCTATGGATTTGGATATTGTTTACGAAGACGATACCGTCATCGTCGT
CAACAAACCGGCCGGACTGGTGGTGCATCCGGCGGCGGGCAACTGGACGG
GGACGCTGCTCAACGGCCTGTTGGCGCATTGCCCCGAGCTGTCCCAAATT
CCGCGCGCGGGCATCGTACACCGTTTGGACAAAGAAACCAGCGGGCTGAT
GGTGGTTGCCAAAACCCTGCCGGCGCAAAATTCCCTCGTGAGGCAGCTTC
AAGAACGCACGGTCAAACGCATCTACCGCGCCGTCGCCAACGGCATCGTC
CCCTTCGACGGTAAAATCGAAACCCAAATCGGACGCGATCCGCACAACCG
CCTGAAAATGGCAGCCGTCAAATTCGGCGGCAAGCCTGCCGTAACCCACG
TCAAAGTGTTGGAACGCTATCTTGCCCACAGCTACATCGAATGCTCGCTC
GGAACGGGCAGGACGCACCAAATCCGCGTCCATATGCGCGAGGCCAACCA
TCCGCTTGCCGGCGACCCGGTTTACGGCAACCCGCGCCATCCGTGCGGCG
ACACGGTGAAAGAAGCCGTTAAAAGTTTGGGCGCGCGTCAGGCGTTGCAC
GCCTACCGCTTGAGTTTTACCCATCCGGAAAGCGGCGAAACCGTTTCGTT
TGAGGCACCGATTCCGGACGACATATATCATTTGTTGTCCGTCCTCCGTC
TTGAAGCCGGTTTGGATTCGTCTTTGAGCAATGAAGAGGAATGGCAGGAC
AAATTCGGCGCGGACGACGATGACGATTGGAACGAAGACGACTACGATGT
CGAAGTGGTTTATGTAAGGGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy