Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0236 IGR0235 IGR0234 IGR0232 IGR0233 IGR0233.1 IGR0231 NG0280 comL, - NG0277 NG0279 iga, - NG0275 NG0282 NG0281 holA, - NG0283 rluD, - NG0278 comA, - NG0276 NG0280 comL, - NG0277 NG0279 iga, - NG0275 NG0282 NG0281 holA, - NG0283 rluD, - NG0278 comA, - NG0276 NG0280 comL, - NG0277 NG0279 iga, - NG0275 NG0282 NG0281 holA, - NG0283 rluD, - NG0278 comA, - NG0276
* Calculated from Protein Sequence

Gene ID: NG0277

DNA Molecule Name:
1  

Genbank ID:
1107833

Gene Name:
comL  

Definition:
competence lipoprotein (peptidoglycan-linked lipoprotein precursor)

Gene Start:
280553

Gene Stop:
279753

Gene Length:
801

Molecular Weight*:
30825

pI*:
9.60

Net Charge*:
5.16

EC:
1.4.1.4  

Functional Class:
Cellular processes; Transformation  

Pathway: pathway table
Glutamate metabolism
Nitrogen metabolism

Primary Evidence:
Fussenegger,M., Facius,D., Meier,J. and Meyer,T.F. 1996.
A novel peptidoglycan-linked lipoprotein (ComL) that functions in natural transformation competence of Neisseria gonorrhoeae.
Mol. Microbiol. 19 (5): 1095-1105.
Medline: 96249702.

Comment:
Oklahoma ID: NGO.277c

For other 'com' genes, see NG0276 (comA), NG1177 (comE), NG1550 (comM), NG1726 (comF).

Blast Summary:  PSI-Blast Search
NG0277 is identical to a previously sequenced N.gonorrhoeae protein in GenBank, 5921830, a predicted competence lipoprotein (ComL).

NG0277 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a competence lipoprotein: residues 1-267 are 98% similar to residues 1-267 of NG0277.

Numerous significant hits in gapped BLAST; e.g. residues 1-251 are 43% similar to gb|AAG07933.1|AE004868_4 competence protein ComL of Pseudomonas aeruginosa, residues 1-244 are 37% similar to dbj|BAB36881.1| hypothetical protein of Escherichia coli O157:H7.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 9

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 35-255 are identical to a (PROTEIN REPEAT TPR DOMAIN NUCLEAR PUTATIVE RECEPTOR) protein domain (PD000069) which is seen in COML_NEIGO.

Residues 29-244 are 45% similar to a (PROTEIN LIPOPROTEIN PRECURSOR MEMBRANE SIGNAL RLUD-PHEL) protein domain (PD013537) which is seen in YPIY_PSEAE.

Residues 1-34 are identical to a (COMPETENCE LIPOPROTEIN COML PRECURSOR) protein domain (PD108616) which is seen in COML_NEIGO.



Paralogs:  Local Blast Search


NG0277 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 246 (E-value = 2.1e-139) place NG0277 in the UPF0169 family which is described as Uncharacterised protein family (UPF0169) (PF03696)

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  
gram negative signal  
1  
18

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKKILLTVSLGLALSACATQGTADKDAQITQDWSVEKLYAEAQDELNSSN
YTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRR
LHPQHPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAF
AELVQRFPNSKYAADATARMVKLVDALGGNEMSVARYYMKRGAYIAAANR
AKKIIGSYQNTRYVEESLAILELAYKKLDKPQLAADTRRVLETNFPKSPF
LTHAWQPDDMPWWRYWH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAATTCTTTTAACGGTTTCATTAGGTTTGGCACTGAGTGCCTG
TGCCACTCAAGGTACGGCCGATAAAGATGCCCAGATTACCCAAGATTGGA
GTGTGGAGAAGCTCTATGCCGAAGCCCAGGACGAATTGAACAGCAGCAAT
TATACGCGGGCTGTCAAGTTATACGAAATCTTGGAATCGCGCTTCCCCAC
CAGCCGCCATGCCCGGCAATCCCAACTGGATACCGCATACGCCTATTATA
AAGACGATGAAAAAGACAAGGCTCTGGCGGCAATCGAACGCTTCCGCCGC
CTCCATCCGCAGCATCCGAACATGGATTACGCGCTGTACCTGCGCGGCTT
GGTGCTGTTTAACGAAGATCAGTCCTTCCTGAACAAACTGGCCTCGCAAG
ACTGGTCCGACCGCGACCCGAAAGCCAACCGCGAAGCGTACCAGGCGTTT
GCGGAACTCGTCCAACGCTTCCCGAACAGCAAATACGCCGCCGATGCAAC
CGCACGCATGGTCAAACTGGTCGATGCTTTGGGCGGCAATGAAATGTCGG
TGGCGCGTTACTACATGAAACGCGGCGCATATATCGCCGCCGCCAACCGC
GCCAAAAAAATTATCGGCAGCTATCAAAATACACGCTATGTCGAAGAATC
ACTGGCCATATTGGAACTTGCCTACAAGAAGTTGGACAAGCCCCAGCTTG
CCGCCGATACGCGCCGCGTATTGGAAACCAACTTCCCGAAAAGCCCGTTT
TTGACGCACGCTTGGCAGCCCGACGATATGCCCTGGTGGCGTTACTGGCA
T


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy