Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0232 IGR0230 IGR0229.1 IGR0229 IGR0231 ksgA, - NG0272 iga, - NG0275 NG0273 trpB, - NG0274 comA, - NG0276 ksgA, - NG0272 iga, - NG0275 NG0273 trpB, - NG0274 comA, - NG0276 ksgA, - NG0272 iga, - NG0275 NG0273 trpB, - NG0274 comA, - NG0276
* Calculated from Protein Sequence

Gene ID: NG0275

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
iga  

Definition:
IgA protease precursor (IgA-specific metalloendopeptidase precursor) (IgA-specific serine endopeptidase precursor)

Gene Start:
277075

Gene Stop:
272297

Gene Length:
4779

Molecular Weight*:
175919

pI*:
10.10

Net Charge*:
39.19

EC:
3.4.21.72  3.4.24.13  

Functional Class:
Cellular processes; Protein and peptide secretion  
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Primary Evidence:
Pohlner,J., Halter,R., Beyreuther,K. and Meyer,T.F. 1987.
Gene structure and extracellular secretion of Neisseria gonorrhoeae
IgA protease.
Nature 325 (6103): 458-462.
Medline: 87115823.

Halter,R., Pohlner,J. and Meyer,T.F. 1989.
Mosaic-like organization of IgA protease genes in Neisseria gonorrhoeae generated by horizontal genetic exchange in vivo.
EMBO J. 8 (9): 2737-2744.
Medline: 90060036.

Kettner,C.A. 1990. Inhibition of IgA1 proteinases from Neisseria gonorrhoeae and Hemophilus influenzae by peptide prolyl boronic acids.
J. Biol. Chem. 265 (7): 3738-3743.
Medline: 90154052.

Lomholt,H., Poulsen,K. and Kilian,M. 1995.
Comparative characterization of the iga gene encoding IgA1 protease in Neisseria meningitidis, Neisseria gonorrhoeae and Haemophilus
influenzae.
Mol. Microbiol. 15 (3): 495-506.
Medline: 95302961.


Comment:
Oklahoma ID: NGO.275c

Blast Summary:  PSI-Blast Search
NG0275 is similar to a previously sequenced N.gonorrhoeae protein in GenBank, 44869, a predicted IgA protease precursor protein: residues 1-1532 are 86% similar to residues 1-1593 of NG0275.

NG0275 is orthologously related to CAA57857, Neisseria meningitidis, a IgA1 protease: residues 1-1561 are 87% similar to residues 1-1593 of NG0275.

Numerous significant hits in gapped BLAST; e.g. residues 1-1593 are 45% similar to gb|AAA24969.1| IgA1 protease of Haemophilus influenzae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** PR00921 (IgA-specific serine endopeptidase (S6) signature) with a combined E-value of 1.1e-141.
    PR00921A    35-55
    PR00921B    151-171
    PR00921C    276-294
    PR00921D    631-648
    PR00921E    654-676
    PR00921F    677-699
    PR00921G    719-733
    PR00921H    775-794
    PR00921I    953-967


ProDom Summary:  Protein Domain Search
Residues 769-805 are identical to a (PROTEASE PRECURSOR HYDROLASE SERINE) protein domain (PD008859) which is seen in IGA_NEIGO.

Residues 968-1020 are 96% similar to a (PROTEASE IGA-SPECIFIC SERINE) protein domain (PD039829) which is seen in IGA_NEIGO.

Residues 633-768 are 91% similar to a (PROTEASE SIGNAL PRECURSOR HYDROLASE) protein domain (PD002581) which is seen in IGA_NEIGO.

Residues 547-632 are 77% similar to a (PROTEASE IGA-SPECIFIC SERINE) protein domain (PD043900) which is seen in Q51169_NEIME.

Residues 821-967 are 99% similar to a (SIGNAL PRECURSOR PROTEASE PROTEIN) protein domain (PD002475) which is seen in IGA_NEIGO.

Residues 1305-1593 are 95% similar to a (PROTEASE PRECURSOR HYDROLASE SERINE) protein domain (PD007723) which is seen in IGA_NEIGO.

Residues 1240-1287 are 62% similar to a (PROTEASE IGA-SPECIFIC SERINE) protein domain (PD028418) which is seen in Q51169_NEIME.



Paralogs:  Local Blast Search


NG0275 is paralogously related to NG2105 (Cell envelope; Surface polysaccharides, lipopolysaccharides and antigensadhesin penetration protein; IgA-specific serine endopeptidase) (1e-120), NG1286 (translation initiation factor IF-2) (3e-09), NG1785 (ribonuclease E) (2e-06), NG0265 (tetrapac protein) (1e-05), NG1443 (probable chromosome segregation protein) (2e-05) and NG1549 (conserved hypothetical protein) (1e-04).


Pfam Summary:  Pfam Search
Residues 852 to 973 (E-value = 1.4e-08) place NG0275 in the Pertactin family which is described as Pertactin (PF03212)
Residues 1333 to 1593 (E-value = 5.8e-45) place NG0275 in the Autotransporter family which is described as Autotransporter beta-domain (PF03797)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
27
cleavable N-terminal sequence  
1  
27
non-globular  
617  
693
non-globular  
972  
1020
coil-coil  
1021  
1070
coil-coil  
1097  
1189
non-globular  
1192  
1347

PDB Hit:
pdb|1DAB|1DAB-A THE STRUCTURE OF BORDETELLA PERTUSSIS VIRULENCE 49.2 5e-06

Gene Protein Sequence:
MKAKRFKINAISLSIFLAYALTPYSEAALVRDDVDYQIFRDFAENKGKFF
VGATDLSVKNKRGQNIGNALSNVPMIDFSVADVNKRIATVVDPQYAVSVK
HAKAEVHTFYYGQYNGHNDVADKENEYRVVEQNNYEPHKAWSASNLGRLE
DYNMARFNKFVTEVAPIAPTDAGGGLDTYKDKNRFSSFVRIGAGRQLVYE
KGVYHQEGNEKGYDLRDLSQAYRYAIAGTPYKDINIDQTMNTEGLIGFGN
HNKQYSAEELKQALSQDALTNYGVLGDSGSPLFAFDKQKNQWVFLGTYDY
WAGYGKKSWQEWNIYKKEFADKIKQHDNAGTVKGNGEHHWKTTGTNSHIG
STAVRLANNEGDANNGQNVTFEDNGTLVLDQNINQGAGGLFFKGDYTVKG
ANNDITWLGAGIDVADGKKVVWQVKNPNGDRLAKIGKGTLEINGTGVNQG
QLKVGDGTVILNQKADSNQKVQAFSQVGIVSGRGTLVLNSPDQINPNNLY
FGFRGGRLDANGNDLTFEHIRNVDEGARIVNHNTDHASTITLTGKSLITN
PNSLSVHSIQNDYDEDNYSYYYRPRRPIPQGKDLYYKNYRYYALKSGGSV
NAPMPENGQTENNDWILMGSTQEEAKKNAMNHKNNQRISGFSGFFGEENG
KGHNGALNLNFNGKSAQNRFLLTGGANLNGKISVTQGNVLLSGRPTPHAR
DFVNKSSARKDAHFSKNNEVVFEDDWINRTFKAAEIAVNQSASFSSGRNV
SDITANITATDNAKVNLGYKNGDEVCVRSDYTGYVTCNTGNLSDKALNSF
DATRINGNVNLNQNAALVLGKAALWGQIQGQGNSRVSLNQHSKWHLTGDS
QVHNLSLADSHIHLNNASDAQSANKYHTIKINHLSGNGHFHYLTDLAKNL
GDKVLVKESASGHYQLHVQNKTGEPNQEGLDLFDASSVQDRSRLFVSLAN
HYVDLGALRYTIKTENGITRLYNPYAGNRRPVKPAPSPAANTASQAQKAT
QTDGAQIAKPQDIVVAPPSPQANQAEEAKRQQAKAEQVKRQQAEAGRKSA
ELSAKQRAGEEERRQTAQSQPQRRKRRAAPQDYMAVSQDRPKRRGHRSVQ
QNNVEIAQAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRKAEAE
EAKHQAAELAHRQEAKRKAAESAKRKAEEEEHRQTAQSQPQRRKRRAAPQ
DYMAVSQDRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEE
IPLDALEDEDVSESVDTSDKQPQDNTELHEKVEAVSLQPRAAQPRTQAAA
QADAVSTNTNSALSDAMASTQSILLDTGASLTRHIAQKSRADAEKNSVWM
SNTGYGRDYASAQYRRFSSKRTQTQIGIDRSLSENMQIGGVLTYSDSQHT
FDQAGGKNTFVQANLYGKYYLNDAWYVAGDIGAGSLRSRLQTQQKANFNR
TSIQTGLTLGNTLKINQFEIVPSAGIRYSRLSSADYKLGDDSVKVSSMAV
KTLTAGLDFAYRFKVGNLTVKPLLSAAYFANYGKGGVNVGGKSFAYKADN
QQQYSAGAALLYRNVTLNVNGSITKGKQLEKQKSGQIKIQIRF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGCCAAACGTTTTAAAATTAACGCCATATCCTTATCCATCTTTCT
TGCCTATGCCCTTACGCCATACTCAGAAGCGGCATTGGTGAGAGACGATG
TCGATTATCAAATATTCCGTGACTTTGCAGAAAACAAAGGCAAATTTTTT
GTCGGCGCAACCGATTTATCAGTGAAAAACAAACGAGGTCAAAACATCGG
CAACGCGTTATCCAACGTACCGATGATTGATTTTAGCGTTGCAGATGTCA
ACAAACGCATAGCAACGGTAGTCGATCCCCAATATGCCGTCAGCGTCAAA
CACGCCAAAGCAGAAGTCCATACTTTTTATTACGGCCAATACAACGGTCA
TAATGATGTAGCCGACAAAGAAAATGAATACCGCGTTGTCGAACAAAATA
ACTATGAACCCCATAAAGCTTGGAGTGCGAGCAATTTAGGCCGCCTCGAA
GATTATAATATGGCGCGTTTTAATAAGTTTGTAACCGAAGTGGCACCGAT
TGCACCAACTGATGCCGGCGGCGGATTAGATACTTACAAAGATAAAAACC
GTTTTTCCTCTTTTGTCAGAATCGGTGCGGGCAGGCAATTAGTTTATGAA
AAAGGGGTTTATCATCAAGAAGGAAATGAAAAAGGCTACGATTTGCGCGA
TCTTTCACAAGCCTATCGTTATGCCATTGCAGGTACGCCTTATAAAGATA
TTAATATTGACCAAACAATGAATACCGAAGGTTTGATCGGCTTTGGTAAT
CATAATAAACAGTATTCGGCAGAAGAACTTAAACAAGCACTTTCGCAAGA
TGCGTTAACAAATTACGGCGTGTTGGGCGATAGCGGCTCTCCGTTATTTG
CTTTTGACAAACAAAAAAATCAATGGGTCTTTTTGGGAACTTACGATTAT
TGGGCAGGTTACGGAAAAAAATCATGGCAAGAATGGAATATCTATAAAAA
AGAATTTGCAGATAAAATCAAACAACACGATAACGCCGGCACCGTCAAAG
GTAATGGAGAACATCATTGGAAAACCACGGGTACAAACAGCCATATCGGT
TCGACAGCGGTAAGGCTTGCCAACAATGAAGGAGATGCGAACAACGGACA
AAATGTTACCTTTGAAGACAACGGCACTTTGGTATTGGATCAAAACATCA
ACCAAGGCGCGGGCGGCCTGTTTTTCAAAGGCGATTACACAGTCAAAGGC
GCAAATAATGACATCACTTGGTTAGGTGCGGGGATTGATGTTGCCGACGG
CAAAAAAGTCGTTTGGCAAGTCAAAAATCCGAATGGCGACAGATTGGCAA
AAATCGGCAAAGGCACTTTGGAAATAAACGGCACAGGCGTTAACCAAGGG
CAATTAAAAGTCGGCGACGGTACGGTTATTCTGAATCAAAAAGCCGATTC
AAACCAAAAAGTTCAGGCTTTCTCCCAAGTCGGCATTGTCAGCGGACGCG
GTACATTGGTGCTGAACAGTCCGGACCAGATTAACCCGAATAATCTGTAT
TTCGGTTTCCGTGGCGGTCGTTTGGATGCCAATGGCAATGACTTGACTTT
TGAACACATCCGCAACGTGGATGAAGGCGCGCGCATTGTCAACCACAACA
CAGACCACGCCTCCACAATCACACTAACGGGTAAATCTTTAATTACCAAT
CCGAACAGCCTTTCGGTACATAGTATACAAAATGACTATGACGAAGATAA
TTATAGTTATTATTACCGGCCAAGGCGACCCATCCCACAAGGCAAAGATC
TTTATTACAAAAACTATCGTTATTACGCCCTAAAATCCGGTGGCAGTGTT
AACGCACCGATGCCCGAAAACGGACAAACGGAAAATAACGACTGGATTTT
AATGGGCAGCACACAAGAAGAAGCCAAGAAAAACGCGATGAACCATAAAA
ACAATCAGCGTATTAGCGGTTTTAGCGGTTTCTTTGGCGAAGAAAACGGA
AAAGGACATAACGGCGCATTAAACCTTAATTTCAATGGCAAAAGCGCGCA
AAACCGTTTCTTGTTAACAGGCGGCGCCAATTTAAACGGAAAAATAAGCG
TAACTCAAGGCAATGTCTTGTTATCAGGTCGTCCAACACCACACGCAAGA
GATTTTGTGAACAAATCTTCAGCCCGAAAAGACGCACATTTCTCCAAAAA
CAATGAAGTCGTATTTGAAGACGACTGGATAAACCGCACATTCAAAGCCG
CAGAAATTGCGGTTAACCAATCCGCATCATTCTCTTCCGGCAGAAATGTA
TCCGACATCACCGCCAACATCACCGCAACAGACAACGCCAAAGTAAATTT
GGGTTACAAAAACGGCGATGAGGTTTGCGTGCGCTCGGACTATACCGGTT
ACGTTACCTGCAACACAGGCAACTTATCCGATAAGGCTTTAAACAGCTTT
GATGCGACACGGATTAACGGCAATGTGAATTTGAATCAGAATGCGGCATT
GGTCTTGGGCAAGGCTGCATTATGGGGGCAAATTCAAGGGCAAGGAAACA
GCCGTGTCAGCCTAAACCAACATAGCAAATGGCATTTGACCGGCGACAGC
CAAGTACACAATCTGTCATTGGCGGATAGCCATATTCATTTGAACAACGC
TTCCGATGCGCAAAGTGCAAATAAATACCACACGATCAAAATCAATCATT
TATCCGGTAACGGGCATTTTCATTATCTGACGGACTTGGCGAAAAATCTT
GGGGATAAAGTGCTTGTGAAGGAATCCGCATCCGGCCATTATCAGCTCCA
TGTTCAAAATAAAACAGGCGAACCTAATCAGGAAGGGCTGGATCTCTTTG
ATGCATCATCCGTACAAGACCGCTCCCGCCTTTTTGTTTCCTTGGCAAAT
CATTACGTCGATTTAGGCGCATTGCGTTATACAATCAAAACAGAAAACGG
TATTACCCGGTTGTACAATCCTTATGCCGGGAACCGCCGCCCAGTCAAGC
CGGCCCCGTCTCCTGCCGCAAACACGGCTTCTCAAGCACAAAAGGCAACA
CAAACGGACGGTGCACAAATTGCCAAACCTCAAGATATTGTCGTCGCACC
GCCCAGCCCGCAAGCAAATCAAGCCGAAGAAGCAAAACGCCAACAAGCAA
AAGCGGAGCAAGTGAAGCGTCAGCAAGCAGAAGCAGGGCGTAAATCGGCA
GAGTTGTCGGCAAAACAAAGGGCCGGGGAAGAGGAACGCCGTCAAACAGC
CCAATCCCAGCCGCAACGCCGCAAACGCCGTGCCGCACCGCAGGATTATA
TGGCAGTTTCCCAAGACCGTCCGAAACGCCGCGGACACCGTTCGGTACAG
CAAAACAATGTGGAAATTGCCCAAGCCCAAGCAGAACTTGCGCGCCGACA
GCAGGAAGAACGCAAAGCGGCAGAGTTGTTGGCAAAACAAAGGGCAGAAG
CCGAACGTGAGGCTCAAGCATTGGCTGCGCGCCGAAAAGCCGAAGCCGAA
GAGGCAAAACACCAAGCTGCCGAACTTGCACATCGCCAGGAAGCAAAACG
CAAAGCGGCAGAATCCGCGAAACGAAAAGCTGAGGAAGAAGAGCACCGTC
AAACAGCCCAATCCCAGCCGCAACGCCGCAAACGCCGTGCCGCACCGCAG
GATTATATGGCAGTTTCCCAAGACCGTCCGAAACGTCGCGGACGCAGATC
TACTCTGCCGGCACCGCCCTCGCCATCATTTGATTCATCAGCTTACGCAG
CACCCAGGGCCTTGCATAATCCGGACTGGTATGAAAATGATTATGAAGAA
ATCCCCTTGGATGCGCTGGAAGATGAAGATGTATCCGAATCGGTTGACAC
ATCAGACAAACAGCCTCAAGACAATACGGAACTTCATGAAAAAGTTGAGG
CAGTGAGTTTGCAACCAAGAGCCGCGCAGCCGCGAACCCAAGCCGCCGCG
CAAGCCGATGCAGTCAGCACCAATACTAACTCGGCTTTATCTGACGCAAT
GGCAAGCACGCAATCTATCTTGTTGGATACAGGTGCTTCATTAACACGGC
ACATTGCACAAAAATCACGCGCTGATGCCGAAAAAAACAGTGTTTGGATG
TCAAACACCGGTTATGGCCGTGATTATGCTTCCGCACAATATCGCCGGTT
TAGTTCGAAACGCACGCAAACACAAATCGGCATTGACCGCAGCTTGTCCG
AAAATATGCAGATAGGCGGAGTATTGACTTACTCTGACAGTCAGCATACT
TTTGATCAGGCGGGCGGCAAAAATACTTTTGTGCAAGCCAACCTTTATGG
TAAGTATTATTTAAATGATGCTTGGTATGTGGCCGGCGATATTGGTGCGG
GCAGCTTGAGAAGCCGGTTACAAACGCAGCAAAAAGCAAACTTTAACCGA
ACAAGCATCCAAACCGGCCTTACTTTGGGCAATACGCTGAAAATCAATCA
ATTCGAGATTGTCCCTAGTGCGGGTATCCGTTACAGCCGCCTGTCATCTG
CAGATTACAAGTTGGGTGACGACAGTGTTAAAGTAAGTTCTATGGCAGTG
AAAACACTAACGGCCGGACTGGATTTTGCTTATCGGTTTAAAGTCGGCAA
CCTTACCGTAAAACCCTTGTTATCTGCAGCTTACTTTGCCAATTATGGCA
AAGGCGGCGTGAATGTGGGCGGTAAATCCTTCGCCTATAAAGCAGATAAT
CAACAGCAATATTCAGCAGGCGCCGCGTTACTGTACCGTAATGTTACATT
AAACGTAAATGGCAGTATTACAAAAGGAAAACAATTGGAAAAACAAAAAT
CCGGACAAATTAAAATACAGATTCGTTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy