Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0224 IGR0228 IGR0226 IGR0225 IGR0230 IGR0229.1 IGR0227 IGR0229 NG0268 folI, - NG0267 NG0270 NG0271 glnQ, - NG0269 ksgA, - NG0272 iga, - NG0275 NG0273 trpB, - NG0274 NG0268 folI, - NG0267 NG0270 NG0271 glnQ, - NG0269 ksgA, - NG0272 iga, - NG0275 NG0273 trpB, - NG0274 folI, - NG0267 NG0270 NG0271 glnQ, - NG0269 ksgA, - NG0272 iga, - NG0275 NG0268 NG0273 trpB, - NG0274
* Calculated from Protein Sequence

Gene ID: NG0274

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trpB  

Definition:
tryptophan synthase, beta subunit

Gene Start:
271016

Gene Stop:
272215

Gene Length:
1200

Molecular Weight*:
43448

pI*:
6.10

Net Charge*:
-7.55

EC:
4.2.1.20  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Kishan,V. and Hillen,W. 1990.
Molecular cloning, nucleotide sequence, and promoter structure of the Acinetobacter calcoaceticus trpFB operon.
J. Bacteriol. 172 (10): 6151-6155.
Medline: 91009002.

Rondard P, Bedouelle H.
Mutational scanning of a hairpin loop in the tryptophan synthase beta-subunit implicated in allostery and substrate channeling.
Biol Chem. 2000 Dec;381(12):1185-93.
PMID: 11209753

Eckert SE, Kübler E, Hoffmann B, Braus GH.
The tryptophan synthase-encoding trpB gene of Aspergillus nidulans is regulated by the cross-pathway control system.
Mol Gen Genet. 2000 Jun;263(5):867-76.
PMID: 10905354

Comment:
Oklahoma ID: NGO.274

For the alpha chain, see NG0248. For other trp genes, see NG0261 (trpF), NG0872 (trpE), NG1203 (trpD), NG1204 (trpG), NG1721 (trpC).

Blast Summary:  PSI-Blast Search
NG0274 is orthologously related to AE002424, Neisseria meningitidis, strain MC58, a tryptophan synthase, beta subunit protein: residues 1-400 are 96% similar to residues 1-400 of NG0274.

Numerous significant hits to tryptophan synthase beta subunit proteins in gapped BLAST; e.g. residues 7-400 are 65% similar to gb|AAA21902.1| tryptophan synthase beta-subunit of Acinetobacter calcoaceticus, residues 7-400 are 67% similar to 5764614 tryptophan synthetase beta subunit of Zymomonas mobilis subsp.
pomaceae, residues 7-392 are 64% similar to pir||B30768 tryptophan synthase beta chain of Pseudomonas putida.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0133
COG name: Tryptophan synthase beta chain
Functional Class:  E
The phylogenetic pattern of COG0133 is amtkyqVcEbrhuj----i--
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000993 (Tryptophan synthase, beta chain) with a combined E-value of 2.1e-185.
    IPB000993A    45-69
    IPB000993B    101-139
    IPB000993C    143-195
    IPB000993D    203-252
    IPB000993E    255-297
    IPB000993F    333-362
    IPB000993G    378-389
    IPB000993E    256-298
***** IPB001926 (Pyridoxal-5'-phosphate-dependent enzymes, beta family) with a combined E-value of 1.4e-13.
    IPB001926A    112-139
    IPB001926B    352-360


ProDom Summary:  Protein Domain Search
Residues 203-392 are 64% similar to a (TRYPTOPHAN SYNTHASE BETA BIOSYNTHESIS) protein domain (PD001443) which is seen in TRPB_PSEPU.

Residues 53-202 are 66% similar to a (LYASE PYRIDOXAL PHOSPHATE SYNTHASE BIOSYNTHESIS) protein domain (PD000323) which is seen in TRPB_LACLA.



Paralogs:  Local Blast Search


NG0274 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 54 to 384 (E-value = 1.1e-107) place NG0274 in the PALP family which is described as Pyridoxal-phosphate dependent enzyme (PF00291)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1KFE|1KFE-B CRYSTAL STRUCTURE OF ALPHAT183V MUTANT OF 427.0 0e+00
pdb|1A50|1A50-B CRYSTAL STRUCTURE OF WILD-TYPE TRYPTOPHAN 427.0 0e+00
pdb|1A5S|1A5S-B CRYSTAL STRUCTURE OF WILD-TYPE TRYPTOPHAN 427.0 0e+00
pdb|1A5A|1A5A-B CRYO

Gene Protein Sequence:
MKNYHAPDEKGFFGEHGGLYVSETLIPALKELEQAYNEAKNDPEFWAEFR
RDLKHYVGRPSPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQA
LLARRMGKKRVIAETGAGQHGVASATVAARFGMTCDVYMGADDIQRQMPN
VFRMKLLGANVIGVDSGSRTLKDAMNEAMREWVARVDDTFYIIGTAAGPA
PYPEMVRDFQCVIGNEAKAQMQEATGRQPDVAVACVGGGSNAIGLFYPYI
EEENVRLVGVEAGGLGVDTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEG
IIPALESSHAVAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIEL


Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAACTACCACGCGCCCGACGAAAAGGGCTTTTTCGGCGAACACGG
CGGGCTTTATGTTTCCGAAACCCTGATTCCCGCTTTGAAAGAGCTGGAAC
AGGCCTACAACGAAGCGAAAAACGATCCTGAATTTTGGGCGGAGTTCCGC
CGCGATTTGAAACATTATGTCGGCAGGCCCAGCCCCGTTTACCACGCCGC
GCGGTTGTCCGAGCATTTGGGCGGCGCGCAAATCTGGTTGAAGCGCGAAG
ACTTGAACCACACCGGCGCGCACAAGGTCAACAACACCATCGGTCAGGCA
TTGCTTGCCCGCCGTATGGGCAAAAAACGCGTCATCGCCGAAACCGGCGC
GGGTCAGCACGGCGTGGCTTCTGCCACCGTCGCCGCACGTTTCGGCATGA
CTTGCGACGTGTACATGGGTGCGGACGATATTCAACGCCAAATGCCGAAT
GTGTTCCGTATGAAGCTGCTTGGTGCGAATGTCATCGGCGTTGACAGTGG
CAGCCGTACTTTGAAAGACGCGATGAACGAAGCGATGCGCGAATGGGTCG
CCCGAGTGGACGATACGTTCTACATCATCGGCACCGCCGCCGGCCCCGCG
CCGTATCCCGAAATGGTGCGTGATTTCCAATGCGTCATCGGCAACGAAGC
CAAAGCGCAGATGCAGGAAGCCACCGGCAGACAGCCCGACGTCGCCGTTG
CCTGCGTCGGCGGCGGCTCGAACGCCATCGGTTTGTTCTATCCCTATATC
GAAGAAGAAAACGTACGTTTGGTCGGCGTAGAAGCAGGCGGTTTGGGCGT
GGATACGCCTGACCACGCCGCGCCGATTACTTCGGGCGCACCGATTGGCG
TACTGCACGGCTTCCGCAGCTATCTGATGCAGGACGAAAACGGCCAAGTC
TTGGGGACGCACTCTGTTTCCGCAGGCTTGGATTACCCCGGCATCGGCCC
GGAACACAGCCATCTGCACGACATCAAGCGCGTCGAATACACCGTTGCCA
AAGATGACGAAGCACTCGAAGCCTTTGACTTGCTCTGCCGATTCGAGGGC
ATCATCCCCGCGCTCGAATCCAGCCACGCCGTTGCTTGGGCGGTGAAAAA
CGCGCCGAAAATGGGTAAAGACCAAGTGATTTTGGTCAACCTGTCGGGTC
GCGGCGACAAAGACATCAATACCGTGGCGAAACTCAAAGGCATTGAGCTG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy