Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0224 IGR0222 IGR0228 IGR0223 IGR0226 IGR0225 IGR0230 IGR0229.1 IGR0227 IGR0229 NG0268 folI, - NG0267 NG0270 NG0271 glnQ, - NG0269 ksgA, - NG0272 tpc, - NG0265 folC, - NG0266 iga, - NG0275 NG0273 trpB, - NG0274 NG0268 folI, - NG0267 NG0270 NG0271 glnQ, - NG0269 ksgA, - NG0272 tpc, - NG0265 folC, - NG0266 iga, - NG0275 NG0273 trpB, - NG0274 folI, - NG0267 NG0270 NG0271 glnQ, - NG0269 ksgA, - NG0272 tpc, - NG0265 folC, - NG0266 iga, - NG0275 NG0268 NG0273 trpB, - NG0274
* Calculated from Protein Sequence

Gene ID: NG0272

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ksgA  

Definition:
dimethyladenosine transferase (S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase) (kasugamycin dimethyltransferase) (high level kasgamycin resistance protein)

Gene Start:
270028

Gene Stop:
269252

Gene Length:
777

Molecular Weight*:
29222

pI*:
7.20

Net Charge*:
0.65

EC:
2.1.1.-  

Functional Class:
Other categories; Drug and analog sensitivity  
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
van Buul,C.P. and van Knippenberg,P.H. 1985.
Nucleotide sequence of the ksgA gene of Escherichia coli: comparison of methyltransferases effecting dimethylation of adenosine in ribosomal RNA.
Gene 38 (1-3): 65-72.
Medline: 86056993.

Pease AJ, Roa BR, Luo W, Winkler ME.
Positive growth rate-dependent regulation of the pdxA, ksgA, and pdxB genes of Escherichia coli K-12.
J Bacteriol. 2002 Mar;184(5):1359-69.
PMID: 11844765

Vila-Sanjurjo A, Squires CL, Dahlberg AE.
Isolation of kasugamycin resistant mutants in the 16 S ribosomal RNA of Escherichia coli.
J Mol Biol. 1999 Oct;293(1):1-8.
PMID: 10512710

Comment:
Oklahoma ID: NGO.272c

Called ErmC in g14324127. According to Pease et al., 2002, the ksgA gene is cotranscribed witrh pdxA (NG1786).

Blast Summary:  PSI-Blast Search
NG0272 is orthologously related to AE002424, Neisseria meningitidis, strain MC58, a dimethyladenosine transferase protein: residues 1-259 are 95% similar to residues 1-259 of NG0272.

Numerous significant hits to dimethyladenosine transferase (S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase) (kasugamycin dimethyltransferase) (high level kasgamycin resistance protein) in gapped BLAST; e.g. residues 4-258 are 49% similar to gb|AAC73162.1| S-adenosylmethionine-6-N',N'-adenosyl (rRNA) dimethyltransferase of Escherichia coli K12, residues 4-258 are 49% similar to dbj|BAB33479.1| dimethyladenosine transferase of Escherichia coli O157:H7, residues 4-254 are 49% similar to gb|AAF93616.1| dimethyladenosine transferase of Vibrio cholerae.


COGS Summary:  COGS Search
BeTs to 17 clades of COG0030
COG name: Dimethyladenosine transferase (rRNA methylation)
Functional Class:  J
The phylogenetic pattern of COG0030 is amtkyqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001737 (Ribosomal RNA adenine dimethylase) with a combined E-value of 1e-38.
    IPB001737A    21-66
    IPB001737B    100-113
    IPB001737C    166-187


ProDom Summary:  Protein Domain Search
Residues 128-252 are 48% similar to a (TRANSFERASE METHYLTRANSFERASE RRNA RESISTANCE PROTEIN) protein domain (PD000922) which is seen in KSGA_HAEIN.

Residues 6-105 are 48% similar to a (TRANSFERASE METHYLTRANSFERASE PROTEIN RRNA RESISTANCE) protein domain (PD000786) which is seen in KSGA_ECOLI.

Residues 13-198 are 33% similar to a (PROTEIN ORF PUTATIVE KINASE) protein domain (PD000146) which is seen in O51536_BORBU.



Paralogs:  Local Blast Search


NG0272 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 256 (E-value = 5.6e-67) place NG0272 in the RrnaAD family which is described as Ribosomal RNA adenine dimethylase (PF00398)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QAM|1QAM-A THE STRUCTURE OF THE RRNA METHYLTRANSFERASE 87.0 3e-18
pdb|1YUB|1YUB SOLUTION STRUCTURE OF AN RRNA METHYLTRANSFERASE 79.2 7e-16
pdb|1QAM|1QAM-A THE STRUCTURE OF THE RRNA METHYLTRANSFERASE 325.0 5e-90
pdb|1YUB|1YUB SOLUT

Gene Protein Sequence:
MKEHKARKRFGQNFLQDTRIIGDIVNAVRPQADDVVIEIGPGLAAITEPL
AKKLNRLHVVEIDRDIVCRLKTLPFADKLVIHEGDVLQFDFNGISGKKKI
VGNLPYNISTPLLFKLAEVADDVADMHFMLQKEVVERMVAAPKSNDYGRL
GVMLQYFFDMELLIDVPPESFDPAPKIDSAVVRMIPVKHRIGKADDFDHF
AKLVKLAFRQRRKTIRNNLKELADDDDLQAVGISPQDRAEHIAPEKYVAL
SNYLADKAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAACACAAAGCCCGCAAGCGTTTCGGGCAGAATTTTTTGCAGGA
CACGCGGATTATCGGCGATATTGTCAACGCCGTGCGCCCGCAGGCGGATG
ATGTCGTGATTGAAATCGGCCCGGGTTTGGCGGCAATTACCGAACCTTTG
GCGAAAAAGCTGAACCGCCTGCACGTTGTCGAAATCGACCGCGACATCGT
ATGCCGTCTGAAAACGCTGCCGTTTGCGGATAAACTGGTGATTCACGAAG
GCGACGTGTTGCAGTTTGATTTCAACGGCATCTCAGGCAAAAAGAAAATC
GTCGGCAACCTGCCGTATAACATCTCCACGCCGCTTTTGTTCAAACTGGC
GGAGGTGGCGGACGATGTCGCCGATATGCACTTTATGTTGCAAAAAGAAG
TGGTCGAGCGCATGGTTGCCGCGCCGAAAAGCAACGACTACGGTCGCTTG
GGTGTGATGCTGCAATATTTTTTCGATATGGAGCTGCTGATTGACGTGCC
GCCCGAATCGTTCGATCCCGCGCCGAAAATCGATTCCGCAGTGGTGCGCA
TGATTCCGGTGAAACACCGTATCGGCAAGGCGGACGATTTCGATCATTTC
GCCAAACTGGTGAAACTCGCCTTCCGCCAACGCCGCAAAACCATACGCAA
CAACCTGAAAGAACTTGCCGACGACGATGATTTGCAGGCAGTCGGCATCA
GTCCGCAAGACCGTGCCGAACACATCGCGCCGGAGAAATATGTGGCGTTG
AGCAATTATCTGGCGGACAAGGCCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy