Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0224 IGR0222 IGR0228 IGR0223 IGR0226 IGR0225 IGR0219 IGR0220 IGR0227 IGR0221 IGR0229 NG0268 folI, - NG0267 NG0270 greB, - NG0262 NG0271 trpF, - NG0261 glnQ, - NG0269 ksgA, - NG0272 tpc, - NG0265 folC, - NG0266 purF, - NG0263 NG0273 NG0268 folI, - NG0267 NG0270 greB, - NG0262 NG0271 trpF, - NG0261 glnQ, - NG0269 ksgA, - NG0272 tpc, - NG0265 folC, - NG0266 purF, - NG0263 NG0273 folI, - NG0267 NG0270 greB, - NG0262 NG0271 trpF, - NG0261 glnQ, - NG0269 ksgA, - NG0272 tpc, - NG0265 folC, - NG0266 purF, - NG0263 NG0264 NG0264 NG0268 NG0273
* Calculated from Protein Sequence

Gene ID: NG0266

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folC  

Definition:
tetrahydrofolylpolyglutamate synthase; dihydrofolate synthase

Gene Start:
266421

Gene Stop:
265150

Gene Length:
1272

Molecular Weight*:
46406

pI*:
6.10

Net Charge*:
-7.13

EC:
6.3.2.12  6.3.2.17  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Primary Evidence:
Fussenegger,M. and Meyer,T.F. 1996.
Cloning and characterization of the Neisseria gonorrhoeae MS11 folC gene.
Mol. Gen. Genet. 250 (3): 277-285.
Medline: 96180644.


Secondary Evidence:
Bognar,A.L., Osborne,C. and Shane,B.
Primary structure of the Escherichia coli folC gene and its
folylpolyglutamate synthetase-dihydrofolate synthetase product and
regulation of expression by an upstream gene
J. Biol. Chem. 262 (25), 12337-12343 (1987)
M:87308246

Kimlova,L.J., Pyne,C., Keshavjee,K., Huy,J., Beebakhee,G. and
Bognar,A.L.
Mutagenesis of the folC gene encoding folylpolyglutamate
synthetase-dihydrofolate synthetase in Escherichia coli
Arch. Biochem. Biophys. 284 (1), 9-16 (1991)
M:91112811



Comment:
Oklahoma ID: NGO.266c

For other 'fol' genes, see NG0267 (folI), NG0323 (folK), NG0857 (folB), NG1342 (folP), NG1694 (folA), NG1999 (folD).

Blast Summary:  PSI-Blast Search
NG0266 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2120881, a predicted tetrahydrofolylpolyglutamate synthase protein.

NG0266 is orthologously related to AAF41110, Neisseria meningitidis, strain MC58, a folylpolyglutamate synthase/dihydrofolate synthase protein: residues 1-424 are 93% similar to residues 1-424 of NG0266.

Numerous significant hits to folylpolyglutamate synthase/dihydrofolate synthase proteins in gapped BLAST; e.g. residues 7-421 are 44% similar to gb|AAF94162.1| folylpolyglutamate synthase/dihydrofolate synthase of Vibrio cholerae, residues 4-424 are 42% similar to dbj|BAB36622.1| dihydrofolate:folylpolyglutamate synthetase of Escherichia coli O157:H7, residues 2-419 are 42% similar to gb|AAG06499.1|AE004735_6 folylpolyglutamate synthetase of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0285
COG name: Folylpolyglutamate synthase
Functional Class:  H
The phylogenetic pattern of COG0285 is ----Yqvcebrhuj---l--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001645 (Folylpolyglutamate synthetase) with a combined E-value of 3.7e-62.
    IPB001645A    42-66
    IPB001645B    69-89
    IPB001645C    115-150
    IPB001645D    155-188
    IPB001645E    408-421


ProDom Summary:  Protein Domain Search
Residues 235-424 are 92% similar to a (SYNTHASE FOLYLPOLYGLUTAMATE FOLC PROTEIN) protein domain (PD008596) which is seen in Q50990_NEIGO.

Residues 41-218 are 99% similar to a (FOLYLPOLYGLUTAMATE SYNTHASE SYNTHETASE) protein domain (PD003937) which is seen in Q50990_NEIGO.

Residues 1-40 are identical to a (FOLC BIFUNCTIONAL PROTEIN INCLUDES:) protein domain (PD164808) which is seen in Q50990_NEIGO.



Paralogs:  Local Blast Search


NG0266 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 283 (E-value = 2.3e-07) place NG0266 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
408  
424

PDB Hit:
pdb|1FGS|1FGS FOLYLPOLYGLUTAMATE SYNTHETASE FROM LACTOBACILLUS 162.0 1e-40
pdb|1JBW|1JBW-A 159.0 7e-40
pdb|1FGS|1FGS FOLYLPOLYGLUTAMATE SYNTHETASE FROM LACTOBACILLUS 162.0 8e-41
pdb|1JBW|1JBW-A 160.0 4e-40

Gene Protein Sequence:
MKTLQDWLSHLETAHSGGLIDMGLERVSEVKKRMNLTPQCPVVVVAGTNG
KGSVCAYLTQIYKQAGFKTGTLTSPHLLHYNERIAINAEPVSDDTIIASF
ERIEAARGEISLTYFEFNALAAVDIFIREQVDVMILEVGLGGRLDAVNAF
DGDCAVVTSVDLDHQAFLGDTVEQVGFEKAGVFRSGKPAICGQNPAPASL
VAHAEAIGAKLLMVQRDFEFHAMENIQWNYRFRPQHSDGPARNRNALPFP
ALRGAYQLSNAACALTVLECLDDRLPVDIGAIKRGLLLVENPGRFQVLPG
RPLTVLDVGHNPHAARALRRNLINLAYAQKRTAVFSMLSDKDIDGVSETV
KDQFDEWYIAPLDVPRGMTADALKAKLEQHHIENIQTFAAVRDAYRAAAS
KAGEDDRIVVFGSFHTVADVMSVL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACACTACAAGACTGGCTCTCGCATTTGGAAACCGCCCACAGCGG
CGGTTTGATCGACATGGGTTTGGAGCGCGTAAGCGAAGTAAAAAAGCGCA
TGAACCTGACACCGCAATGCCCCGTCGTCGTCGTCGCGGGAACAAACGGC
AAAGGTTCGGTCTGCGCCTACCTGACACAGATTTACAAACAGGCAGGCTT
CAAAACCGGCACGCTGACCAGCCCGCATTTATTGCATTACAACGAACGCA
TCGCCATCAACGCCGAACCCGTTTCGGACGATACGATTATTGCCTCTTTC
GAGCGCATCGAAGCCGCGCGCGGCGAAATATCGCTGACTTATTTTGAATT
CAATGCCTTGGCGGCTGTCGACATTTTCATACGCGAACAAGTGGATGTAA
TGATATTGGAAGTCGGCTTGGGCGGACGTTTGGACGCGGTCAACGCGTTT
GACGGCGATTGCGCGGTGGTTACTAGTGTGGATTTGGACCATCAGGCATT
TTTGGGCGATACGGTCGAACAGGTCGGCTTTGAAAAGGCAGGCGTGTTCC
GCAGCGGCAAACCCGCCATCTGCGGTCAAAACCCCGCGCCCGCATCATTG
GTCGCACACGCCGAAGCCATAGGCGCGAAACTGCTGATGGTACAGCGCGA
TTTCGAGTTTCACGCGATGGAAAACATCCAATGGAACTACCGCTTCCGGC
CGCAGCATTCAGACGGCCCCGCACGCAACCGCAATGCCCTGCCCTTCCCC
GCATTGCGCGGCGCATACCAGCTTTCTAACGCCGCCTGCGCGTTGACCGT
ATTGGAATGCCTCGACGACAGACTGCCGGTGGACATTGGTGCAATCAAAC
GCGGGCTGCTGCTGGTTGAAAATCCCGGACGCTTCCAAGTCCTGCCCGGC
CGGCCGCTGACCGTATTGGATGTCGGACACAACCCCCACGCCGCCCGCGC
CCTGCGCCGCAACCTAATCAACCTTGCCTACGCGCAAAAGCGCACCGCCG
TGTTCAGTATGCTGTCCGACAAAGACATAGACGGCGTGTCGGAAACCGTT
AAAGACCAGTTTGACGAGTGGTATATCGCGCCTTTGGACGTGCCGCGCGG
TATGACGGCGGATGCACTGAAAGCCAAATTGGAACAACACCACATCGAAA
ACATACAGACATTCGCCGCCGTCCGCGACGCGTACCGGGCGGCAGCCTCA
AAAGCGGGCGAAGACGACAGAATCGTCGTATTCGGCTCATTTCATACCGT
CGCCGACGTAATGTCGGTACTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy