Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0222 IGR0217 IGR0219 IGR0220 IGR0216 IGR0221 IGR0218 IGR0218.1 IGR0218.2 greB, - NG0262 trpF, - NG0261 tpc, - NG0265 folC, - NG0266 purF, - NG0263 lbpA, - NG0260.1 rnc, - NG0259 era, - NG0260 lbpA, - NG0260.2 greB, - NG0262 trpF, - NG0261 tpc, - NG0265 folC, - NG0266 purF, - NG0263 lbpA, - NG0260.1 rnc, - NG0259 era, - NG0260 lbpA, - NG0260.2 greB, - NG0262 trpF, - NG0261 tpc, - NG0265 folC, - NG0266 purF, - NG0263 NG0264 NG0264 lbpA, - NG0260.1 rnc, - NG0259 era, - NG0260 lbpA, - NG0260.2
* Calculated from Protein Sequence

Gene ID: NG0261

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trpF  

Definition:
N-(5'-phosphoribosyl)anthranilate isomerase

Gene Start:
261215

Gene Stop:
260592

Gene Length:
624

Molecular Weight*:
22515

pI*:
8.60

Net Charge*:
3.10

EC:
5.3.1.24  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Murata,T. 1996.
The trpF nucleotide sequence and its promoter analysis in Pseudomonas aeruginosa.
Microbiol. Immunol. 40 (2): 107-114.
Medline: 97021245.


Henn-Sax M, Thoma R, Schmidt S, Hennig M, Kirschner K, Sterner R.
Two (betaalpha)(8)-barrel enzymes of histidine and tryptophan biosynthesis have similar reaction mechanisms and common strategies for protecting their labile substrates.
Biochemistry. 2002 Oct;41(40):12032-42.
PMID: 12356303

Murata T.
The trpF nucleotide sequence and its promoter analysis in Pseudomonas aeruginosa.
Microbiol Immunol. 1996;40(2):107-14.
PMID: 8867605

Ross CM, Kaplan JB, Winkler ME, Nichols BP.
An evolutionary comparison of Acinetobacter calcoaceticus trpF with trpF genes of several organisms.
Mol Biol Evol. 1990 Jan;7(1):74-81.
PMID: 2299982

Comment:
Oklahoma ID: NGO.261c

For other trp genes, see NG0248 (trpA), NG0274 (trpB), NG0872 (trpE), NG1203 (trpD), NG1204 (trpG), NG1721 (trpC).

Blast Summary:  PSI-Blast Search
NG0261 is orthologously related to AL162754, Neisseria meningitidis, strain Z2491, a putative N-(5'-phosphoribosyl)anthranilate isomerase protein: e.g. residues 1-208 are 96% similar to residues 1-208 of NG0261.

Numerous significant hits to phosphoribosyl anthranilate isomerase proteins in gapped BLAST; e.g. residues 1-200 are 56% similar to gb|AAG06501.1|AE004735_8 N-(5'phosphoribosyl)anthranilate (PRA) isomerase of Pseudomonas aeruginosa, residues 3-200 are 46% similar to gb|AAA21897.1| 5'-phosphoribosyl anthranilate isomerase of Acinetobacter calcoaceticus, residues 4-206 are 43% similar to gb|AAD35232.1|AE001699_9 phosphoribosylanthranilate isomerase of Thermotoga maritima.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0135
COG name: Phosphoribosylanthranilate isomerase
Functional Class:  E
The phylogenetic pattern of COG0135 is amt--qvceb-huj----i--
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 31-200 are 50% similar to a (ISOMERASE PRAI N-5'-PHOSPHORIBOSYLANTHRANILATE) protein domain (PD001436) which is seen in TRPF_PSEAE.



Paralogs:  Local Blast Search


NG0261 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 202 (E-value = 1.1e-64) place NG0261 in the PRAI family which is described as N-(5'phosphoribosyl)anthranilate (PRA) isomerase (PF00697)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
48  
64

PDB Hit:
pdb|1LBM|1LBM-A CRYSTAL STRUCTURE OF PHOSPHORIBOSYL ANTHRANILATE125.0 6e-30
pdb|1DL3|1DL3-A CRYSTAL STRUCTURE OF MUTUALLY GENERATED MONOMERS115.0 9e-27
pdb|1PII|1PII N-(5'PHOSPHORIBOSYL)ANTHRANILATE ISOMERASE 61.3 1e-10
pdb|1LBM|1LBM-A CRYS

Gene Protein Sequence:
MRKIRTKICGITTPEDALYAAHAGADALGLVFYPQSPRAIDIIKAQKIAA
ALPPFVSVVALFVNESAQNIRRILAEVPIHIIQFHGDEDDAFCRQFDRPY
IKAIRVQTASDIRNAATRFPNAQALLFDAYHPSEYGGTGHRFDWTLLAEY
SGKPWVLAGGLTPENVGEAVRITGAEAVDVSGGVEASKGKKDPAKVAAFI
ATANRLSR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGAAAATCCGCACCAAAATCTGCGGCATCACCACACCGGAAGACGC
ACTGTATGCCGCCCACGCCGGCGCAGACGCATTGGGACTGGTTTTTTACC
CCCAAAGCCCCCGCGCTATCGACATCATTAAAGCACAAAAAATCGCCGCC
GCACTGCCGCCGTTTGTCAGCGTTGTCGCCCTTTTCGTCAACGAAAGCGC
GCAAAACATCCGCCGCATCCTTGCCGAAGTGCCGATACACATCATCCAAT
TCCACGGCGACGAAGACGATGCATTCTGCCGGCAGTTCGACCGCCCCTAT
ATTAAAGCCATTCGTGTTCAGACGGCATCAGACATCCGAAACGCCGCCAC
GCGCTTCCCCAACGCTCAGGCACTGCTGTTCGATGCCTATCACCCTTCGG
AATACGGCGGCACCGGACACCGCTTCGACTGGACGCTGTTGGCGGAATAT
TCGGGCAAGCCGTGGGTGCTTGCCGGCGGGCTGACCCCTGAAAACGTCGG
CGAAGCCGTCCGCATCACCGGAGCGGAAGCGGTCGACGTATCCGGCGGCG
TGGAAGCGTCTAAAGGCAAAAAAGACCCCGCCAAAGTCGCCGCCTTTATC
GCAACCGCCAACCGCCTATCCCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy