Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0211 IGR0210.1 IGR0217 IGR0215 IGR0219 IGR0214 IGR0213 IGR0210 IGR0216 IGR0218 IGR0218.1 IGR0218.2 IGR0212 NG0258 nusB, - NG0256 ribH,ribE, - NG0257 greB, - NG0262 tpn, - NG0253 trpF, - NG0261 NG0251 NG0252 lbpA, - NG0260.1 rnc, - NG0259 era, - NG0260 pyrC, - NG0255 lbpA, - NG0260.2 NG0258 nusB, - NG0256 ribH,ribE, - NG0257 greB, - NG0262 tpn, - NG0253 trpF, - NG0261 NG0251 NG0252 lbpA, - NG0260.1 rnc, - NG0259 era, - NG0260 pyrC, - NG0255 lbpA, - NG0260.2 Type: direct, Name:  - 119 Type: direct, Name:  - 120 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 trpF, - NG0261 NG0258 greB, - NG0262 NG0252 lbpA, - NG0260.1 rnc, - NG0259 era, - NG0260 pyrC, - NG0255 lbpA, - NG0260.2 NG0251
* Calculated from Protein Sequence

Gene ID: NG0259

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnc  

Definition:
ribonuclease III

Gene Start:
255967

Gene Stop:
256683

Gene Length:
717

Molecular Weight*:
26934

pI*:
10.10

Net Charge*:
8.60

EC:
3.1.26.3  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Nashimoto,H. and Uchida,H.
DNA sequencing of the Escherichia coli ribonuclease III gene and
its mutations
Mol. Gen. Genet. 201 (1), 25-29 (1985)
M:86039802

March,P.E., Ahnn,J. and Inouye,M.
The DNA sequence of the gene (rnc) encoding ribonuclease III of
Escherichia coli
Nucleic Acids Res. 13 (13), 4677-4685 (1985)
M:85269601

Takiff,H.E., Chen,S.M. and Court,D.L.
Genetic analysis of the rnc operon of Escherichia coli
J. Bacteriol. 171 (5), 2581-2590 (1989)
M:89213943

Ahnn,J., March,P.E., Takiff,H.E. and Inouye,M.
A GTP-binding protein of Escherichia coli has homology to yeast RAS proteins
Proc. Natl. Acad. Sci. U.S.A. 83 (23), 8849-8853 (1986)
M:87067411



Comment:
Oklahoma ID: NGO.259

Blast Summary:  PSI-Blast Search
NG0259 is orthologously related to AE002423, Neisseria meningitidis, strain MC58, a ribonuclease III protein: residues 1-239 are 96% similar to residues 1-239 of NG0259.

Numerous significant hits to ribonuclease III proteins in gapped BLAST; e.g. residues 14-231 are 46% similar to 13431826 ribonuclease III (RNASE III) of Pasteurella multocida, residues 14-228 are 47% similar to gb|AAF95603.1| ribonuclease III of Vibrio cholerae, residues 14-231 are 44% similar to gb|AAC21692.1| ribonuclease III of Haemophilus influenzae Rd.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0571
COG name: dsRNA-specific ribonuclease
Functional Class:  K
The phylogenetic pattern of COG0571 is ----YqvCebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000999 (Ribonuclease III family) with a combined E-value of 5e-59.
    IPB000999A    27-36
    IPB000999B    42-78
    IPB000999C    115-133
    IPB000999D    160-179
    IPB000999E    185-195
    IPB000999F    210-221


ProDom Summary:  Protein Domain Search
Residues 14-86 are 57% similar to a (III RIBONUCLEASE HYDROLASE NUCLEASE) protein domain (PD002508) which is seen in RNC_HAEIN.

Residues 87-212 are 42% similar to a (III RIBONUCLEASE HYDROLASE NUCLEASE) protein domain (PD003300) which is seen in RNC_ECOLI.



Paralogs:  Local Blast Search


NG0259 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 43 to 133 (E-value = 3e-35) place NG0259 in the Ribonuclease_3 family which is described as RNase3 domain (PF00636)
Residues 161 to 228 (E-value = 1.7e-12) place NG0259 in the dsrm family which is described as Double-stranded RNA binding motif (PF00035)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1O0W|1O0W-A CRYSTAL STRUCTURE OF RIBONUCLEASE III (TM1102) 109.0 4e-25
pdb|1I4S|1I4S-A CRYSTAL STRUCTURE OF RNASE III ENDONUCLEASE 80.8 2e-16
pdb|1JFZ|1JFZ-A CRYSTAL STRUCTURE OF MN(II)-COMPLEX OF RNASE III 80.8 2e-16
pdb|1O0W|1O0W-A CRYS

Gene Protein Sequence:
MKDDVLKRQAHTAIQKKLGYAFRDMSLLRRALTHRSHHAKHNERFEFVGD
SILNYTVARMLFDAFPKLTEGELSRLRASLVNEGVLAEMAAEMNVGDGLY
LGAGELKSSGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAERVR
RADFQNQAKDGKTALQEALQARRFALPKYRIEEQIGHADDSMFVISCDLG
ELGFVCRAKGTSRKAAEQEAAKEALKWLEEKLPLKKKKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGACGATGTTTTGAAACGGCAGGCACATACTGCGATACAGAAAAA
GTTAGGCTACGCGTTCCGCGATATGTCGCTTTTGCGGCGGGCTTTGACCC
ACAGGAGCCATCATGCGAAGCACAACGAACGGTTCGAGTTTGTCGGCGAT
TCGATTTTGAATTATACGGTGGCGCGGATGCTGTTTGACGCGTTTCCGAA
GTTGACCGAGGGCGAGTTGTCGCGGTTGAGGGCGAGTCTGGTCAATGAGG
GCGTGCTGGCGGAAATGGCGGCGGAAATGAATGTCGGCGACGGTCTGTAT
TTGGGGGCGGGCGAGTTGAAGAGCAGCGGCTTCAGACGGCCTTCGATACT
GGCGGACGCGATGGAGGCGATGTTTGCCGCCGTCAGCTTCGATGCCGATT
TCAACACGGCGGAAAAGGTGGTGCGCCATTTGTTTGCAGAACGCGTCCGG
CGCGCCGATTTCCAAAATCAGGCAAAAGACGGCAAAACTGCTTTGCAGGA
GGCGTTGCAGGCGCGCCGTTTCGCCTTGCCGAAATACCGCATCGAAGAGC
AAATCGGCCATGCCGACGACAGTATGTTTGTCATTTCCTGCGATTTGGGC
GAACTGGGTTTCGTGTGCCGTGCCAAAGGGACGAGCCGCAAGGCGGCGGA
ACAGGAGGCGGCGAAAGAGGCTTTGAAATGGCTGGAAGAGAAGCTGCCGC
TGAAGAAGAAAAAGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy