Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0211 IGR0210.1 IGR0217 IGR0215 IGR0209 IGR0214 IGR0213 IGR0210 IGR0216 IGR0218 IGR0218.1 IGR0218.2 IGR0212 NG0258 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0251 NG0252 lbpA, - NG0260.1 rnc, - NG0259 accD, - NG0249 era, - NG0260 pyrC, - NG0255 lbpA, - NG0260.2 NG0258 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0251 NG0252 lbpA, - NG0260.1 rnc, - NG0259 accD, - NG0249 era, - NG0260 pyrC, - NG0255 lbpA, - NG0260.2 Type: direct, Name:  - 119 Type: direct, Name:  - 120 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0258 NG0252 lbpA, - NG0260.1 rnc, - NG0259 accD, - NG0249 era, - NG0260 pyrC, - NG0255 lbpA, - NG0260.2 NG0251
* Calculated from Protein Sequence

Gene ID: NG0257

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribH  ribE  

Definition:
riboflavin synthase beta chain (6,7-dimethyl-8-ribityllumazine synthase)

Gene Start:
255426

Gene Stop:
254953

Gene Length:
474

Molecular Weight*:
16952

pI*:
4.20

Net Charge*:
-12.65

EC:
2.5.1.9  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Riboflavin metabolism

Secondary Evidence:
Richter,G., Fischer,M., Krieger,C., Eberhardt,S., Luttgen,H.,
Gerstenschlager,I. and Bacher,A.
Biosynthesis of riboflavin: characterization of the bifunctional
deaminase-reductase of Escherichia coli and Bacillus subtilis
J. Bacteriol. 179 (6), 2022-2028 (1997)
M:97221604

Liao D, Wawrzak Z, Calabrese JC, Viitanen PV, Jordan DB.
Crystal Structure of Riboflavin Synthase.
Structure. 2001 May;9(5):399-408.
PMID: 11377200

Comment:
Oklahoma ID: NGO.257c

For the alpha chain (risA), see NG0755. For other riboflavin synthesis proteins see NG0068, NG0089, NG0704.

Blast Summary:  PSI-Blast Search
NG0257 is orthologously related to AAF41102 Neisseria meningitidis, strain MC58, a riboflavin synthase, beta subunit protein: residues 1-158 are 96% similar to residues 1-158 of NG0257.

Numerous significant hits to riboflavin synthase beta chain (6,7-dimethyl-8-ribityllumazine synthase) in gapped BLAST; e.g. residues 1-146 are 44% similar to gb|AAC22950.1| riboflavin synthase, beta chain of Haemophilus influenzae Rd, residues 1-149 are 44% similar to 12723940 ribiflavin synthase beta chain of Lactococcus lactis, residues 1-149 are 44% similar to gb|AAA86525.1| riboflavin synthase beta subunit of Actinobacillus
pleuropneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0054
COG name: Riboflavin synthase beta-chain
Functional Class:  H
The phylogenetic pattern of COG0054 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002180 (6,7-dimethyl-8-ribityllumazine synthase) with a combined E-value of 1.1e-43.
    IPB002180A    14-38
    IPB002180B    53-67
    IPB002180C    72-92
    IPB002180D    110-129
    IPB002180E    130-142


ProDom Summary:  Protein Domain Search
Residues 14-134 are 49% similar to a (SYNTHASE RIBOFLAVIN BETA CHAIN) protein domain (PD003664) which is seen in RISB_HAEIN.



Paralogs:  Local Blast Search


NG0257 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 149 (E-value = 1.1e-46) place NG0257 in the DMRL_synthase family which is described as 6,7-dimethyl-8-ribityllumazine synthase (PF00885)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
48  
64

PDB Hit:
pdb|1RVV|1RVV-A SYNTHASE/RIBOFLAVIN SYNTHASE COMPLEX OF BACILLUS116.0 2e-27
pdb|1HQK|1HQK-A CRYSTAL STRUCTURE ANALYSIS OF LUMAZINE SYNTHASE 98.3 7e-22
pdb|1C41|1C41-A CRYSTAL STRUCTURES OF A PENTAMERIC FUNGAL AND AN 85.0 7e-18
pdb|1C2Y|1C2Y-A CRYS

Gene Protein Sequence:
MNTIAPNLDGKHLRIGIVQARFTNEIGSQMLKVCCRTLQELGVADENITV
ATVPGALEIPIALMNFASSEKFDALIAIGVVIRGETYHFELVANESGAGI
GRVALDYNIPIANAVLTTENDAQAIERIGEKASDAAKVAVECANLVNLLL
EEQFEDEE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACCATCGCCCCCAACCTCGACGGCAAACACCTCCGCATCGGCAT
CGTACAGGCACGCTTCACCAACGAAATCGGCAGCCAAATGCTCAAAGTCT
GCTGCCGCACCCTCCAAGAATTGGGCGTAGCAGACGAAAACATCACCGTC
GCCACCGTACCCGGCGCGCTTGAAATCCCCATCGCGCTGATGAACTTTGC
CTCTTCCGAAAAATTTGACGCACTGATTGCCATCGGCGTCGTCATCCGTG
GCGAAACCTACCATTTCGAGCTGGTTGCCAACGAATCCGGCGCAGGGATC
GGCCGCGTCGCACTCGACTACAACATCCCGATTGCCAACGCCGTCCTGAC
CACCGAAAACGACGCGCAGGCAATTGAACGGATTGGAGAAAAAGCCTCGG
ATGCCGCCAAAGTCGCCGTAGAATGCGCCAACCTCGTCAACCTTCTGCTC
GAAGAACAGTTTGAAGACGAAGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy