Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0211 IGR0210.1 IGR0217 IGR0208 IGR0215 IGR0209 IGR0214 IGR0213 IGR0210 IGR0216 IGR0218 IGR0218.1 IGR0207 IGR0212 NG0258 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0251 NG0252 lbpA, - NG0260.1 rnc, - NG0259 trpA, - NG0248 accD, - NG0249 era, - NG0260 pyrC, - NG0255 NG0258 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0251 NG0252 lbpA, - NG0260.1 rnc, - NG0259 trpA, - NG0248 accD, - NG0249 era, - NG0260 pyrC, - NG0255 Type: direct, Name:  - 119 Type: direct, Name:  - 120 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0258 NG0252 lbpA, - NG0260.1 rnc, - NG0259 trpA, - NG0248 accD, - NG0249 era, - NG0260 pyrC, - NG0255 NG0251
* Calculated from Protein Sequence

Gene ID: NG0255

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrC  

Definition:
dihydroorotase

Gene Start:
253334

Gene Stop:
254365

Gene Length:
1032

Molecular Weight*:
37055

pI*:
6.40

Net Charge*:
-3.72

EC:
3.5.2.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Brichta,D.M., Brown,T.M., Houghton,J.E. and O'Donovan,G.A. 1996. pyrC (dihydroorotase) Sequence from P. aeruginosa. Unpublished.

Comment:
Oklahoma ID: NGO.255


For other 'pyr' genes, see NG0029 (pyrE), NG1876(pyrI), NG0401 (pyrF), NG0589 (pyrP), NG1212 (pyrG), NG1761 (pyrD), NG1973 (pyrH).

Blast Summary:  PSI-Blast Search
NG0255 is orthologously related to AAF41100 Neisseria meningitidis, strain MC58, a dihydroorotase protein: residues 1-344 are 99% similar to residues 1-344 of NG0255.

Numerous significant hits to dihydroorotase proteins in gapped BLAST; e.g. residues 1-343 are 60% similar to gb|AAF96822.1| dihydroorotase of Vibrio cholerae, residues 4-340 are 60% similar to gb|AAB71134.1| dihydroorotase of Arabidopsis thaliana, residues 4-340 are 59% similar to gb|AAG06915.1|AE004773_4 dihydroorotase of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0418
COG name: Dihydroorotase
Functional Class:  F
The phylogenetic pattern of COG0418 is ----y--ce---uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002195 (Dihydroorotase) with a combined E-value of 4.4e-23.
    IPB002195A    10-20
    IPB002195B    23-48
    IPB002195C    207-218
    IPB002195D    241-252
    IPB002195C    190-201


ProDom Summary:  Protein Domain Search
Residues 4-39 are 72% similar to a (DIHYDROOROTASE DHOASE PYRIMIDINE) protein domain (PD016530) which is seen in PYRC_SYNY3.

Residues 194-340 are 62% similar to a (DIHYDROOROTASE DHOASE PYRIMIDINE BIOSYNTHESIS HYDROLASE) protein domain (PD007441) which is seen in PYRC_PSEAE.

Residues 40-183 are 62% similar to a (DIHYDROOROTASE DHOASE PYRIMIDINE BIOSYNTHESIS HYDROLASE) protein domain (PD007468) which is seen in PYRC_ARATH.



Paralogs:  Local Blast Search


NG0255 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 344 (E-value = 2.1e-79) place NG0255 in the Amidohydro_1 family which is described as Amidohydrolase family (PF01979)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1J79|1J79-A MOLECULAR STRUCTURE OF DIHYDROOROTASE: A 360.0 0e+00

Gene Protein Sequence:
MQTLTIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKPPVVSVA
DALAYKARIMAALPEGSAFEPLMTLYLTDQATPELVREAKAAGIVAFKLY
PAGATTNSDSGVTDLFKLIPVLEEMAKQGILFLVHGEVTDPEIDIFDREA
AFIGRVMKPVLAQVPNLKVVFEHITTAEAARLVLEAGDNVAATVTPQHLL
LNRNDLLVGGVRPHHFCLPVLKRETHRQALVAAVTGEKAHKFFLGTDSAP
HAKSAKENACGCAGMFSAMTAIELYAEVFEKAGALDKLEAFASKNGARFY
GIPENADTITLVKQSQTVPASVPYGDGELVPMRAGGEIGWTVQY

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACCCTGACCATCATCCGACCCGACGATATGCACCTGCACCTGCG
CGACGGCGACGCGCTCAAAGCCGTTGCCCCTTATACCGCCCGCCAGATGG
GGCGCGCCGTCATCATGCCCAACCTCAAACCGCCAGTCGTCAGCGTAGCC
GACGCGCTTGCCTACAAAGCGCGCATTATGGCGGCGTTGCCCGAAGGCAG
CGCGTTTGAGCCGCTGATGACGCTTTACCTGACCGACCAAGCCACGCCCG
AACTCGTGCGCGAAGCCAAAGCCGCCGGCATCGTCGCCTTCAAACTCTAC
CCCGCAGGCGCGACCACCAATTCCGATTCCGGCGTAACCGACCTGTTCAA
GCTCATCCCCGTGTTGGAAGAAATGGCAAAACAGGGCATCCTGTTCCTCG
TTCACGGCGAAGTAACCGACCCCGAAATCGACATTTTCGACCGCGAAGCC
GCCTTTATCGGGCGCGTGATGAAACCCGTTTTGGCGCAAGTGCCGAATCT
CAAAGTCGTGTTCGAACACATCACCACCGCCGAAGCCGCCCGCCTCGTTT
TGGAAGCCGGCGACAACGTTGCCGCCACCGTTACCCCGCAACACCTCCTG
CTCAACCGCAACGACCTCTTGGTCGGCGGCGTGCGCCCCCATCATTTCTG
CCTGCCCGTCCTCAAGCGCGAAACCCACCGTCAGGCATTGGTCGCCGCCG
TTACCGGCGAGAAGGCGCACAAATTCTTCCTCGGCACCGACTCCGCGCCG
CACGCCAAATCCGCCAAAGAAAACGCCTGCGGCTGCGCCGGTATGTTCAG
CGCGATGACCGCTATCGAGCTTTACGCCGAAGTGTTTGAAAAAGCAGGCG
CGTTGGACAAACTCGAAGCCTTCGCCTCGAAAAACGGCGCAAGGTTCTAC
GGCATTCCGGAAAACGCCGACACGATTACCCTTGTCAAACAAAGCCAAAC
CGTTCCCGCAAGCGTCCCTTACGGCGACGGCGAACTTGTCCCGATGCGCG
CGGGCGGCGAAATCGGCTGGACGGTGCAGTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy