Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR0211 IGR0205 IGR0210.1 IGR0208 IGR0206 IGR0209 IGR0214 IGR0213 IGR0210 IGR0203 IGR0204 IGR0207 IGR0212 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0247 NG0244 NG0251 NG0246 NG0252 NG0243 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 pyrC, - NG0255 nusB, - NG0256 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 NG0247 NG0244 NG0251 NG0246 NG0252 NG0243 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 pyrC, - NG0255 Type: direct, Name:  - 119 Type: direct, Name:  - 120 ribH,ribE, - NG0257 tpn, - NG0253 cnp1, - NG0250 nusB, - NG0256 NG0246 NG0252 NG0243 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 pyrC, - NG0255 NG0247 NG0244 NG0251
* Calculated from Protein Sequence

Gene ID: NG0249

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accD  

Definition:
acetyl-CoA carboxylase, carboxyl transferase beta subunit

Gene Start:
249737

Gene Stop:
250606

Gene Length:
870

Molecular Weight*:
31761

pI*:
8.80

Net Charge*:
6.40

EC:
6.4.1.2  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism
Tetracycline biosynthesis

Secondary Evidence:
Li, S.J. and Cronan, J.E. Jr.
The genes encoding the two carboxyltransferase subunits of
Escherichia coli acetyl-CoA carboxylase.
J. Biol. Chem. 267 (24), 16841-16847 (1992)
Medline: 92380982

Comment:
Oklahoma ID: NGO.249

For the alpha subunit, see NG0821.

Blast Summary:  PSI-Blast Search
NG0249 is orthologously related to AAF41097 Neisseria meningitidis, strain MC58, a acetyl-CoA carboxylase, carboxyl transferase beta subunit protein: residues 1-289 are 97% similar to residues 1-289 of NG0249.

Numerous significant hits to acetyl-CoA carboxylase beta subunit proteins in gapped BLAST; e.g. residues 1-286 are 59% similar to gb|AAF84276.1|AE003976_10 acetyl-coenzyme A carboxylase carboxyl transferase subunit beta of Xylella fastidiosa, residues 2-279 are 60% similar to gb|AAG06500.1|AE004735_7 acetyl-CoA carboxylase beta subunit of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0777
COG name: Acetyl-CoA carboxylase beta subunit
Functional Class:  I
The phylogenetic pattern of COG0777 is a--k-qvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01070 (Acetyl-CoA carboxylase carboxyl transferase beta subunit signature) with a combined E-value of 3.4e-52.
    PR01070A    131-145
    PR01070B    165-183
    PR01070C    202-219
    PR01070D    231-242
    PR01070E    253-262


ProDom Summary:  Protein Domain Search
Residues 131-201 are 66% similar to a (CARBOXYLASE BETA CHAIN TRANSFERASE) protein domain (PD001571) which is seen in ACCD_ECOLI.

Residues 30-127 are 56% similar to a (CARBOXYLASE TRANSFERASE SUBUNIT BETA) protein domain (PD003279) which is seen in ACCD_ECOLI.

Residues 202-284 are 71% similar to a (CARBOXYLASE TRANSFERASE SUBUNIT BETA) protein domain (PD003130) which is seen in ACCD_HAEIN.



Paralogs:  Local Blast Search


NG0249 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
97  
175
transmembrane  
111  
127

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSWLDKILPPKIKNRGKDGASNVPEGLWRKCPSCSATVYSTELQQNNQVC
PKCNHHNPLSARQRLNLLLDEEGREEVAGNVKPTDPLKFKDSKKYPDRLS
AARKLTGEDDALVVMKGMMNGLPVVVAAFEFRFIGGSMGSVVGERFVQGV
RRAVADNCPFVCVAASGGARMQEGVNSLMQMTKTSAALHLLTEKRLPFIS
VLTDPTMGGVSASFAFLGDVVLAEPNALIGFAGPRVIEQTVRETLPEGFQ
RAEFLLEKGAIDQIVDRRDMKRRISDLITLLCRQDKVSAT

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTGGTTAGATAAAATCCTGCCACCCAAAATCAAGAATCGTGGGAA
AGACGGTGCTTCCAATGTTCCCGAGGGTTTGTGGCGCAAATGCCCGTCTT
GTTCGGCAACCGTTTATTCGACCGAGTTGCAGCAGAACAATCAGGTCTGC
CCGAAATGCAACCACCACAATCCGTTATCGGCGCGCCAGCGTTTGAACCT
GCTTTTGGATGAGGAAGGCAGGGAGGAAGTTGCGGGTAATGTCAAACCGA
CCGATCCTTTGAAGTTTAAAGACAGCAAAAAATATCCGGACCGTTTGAGT
GCGGCACGCAAGCTGACCGGGGAAGATGACGCGCTGGTGGTGATGAAGGG
GATGATGAACGGTCTGCCCGTCGTCGTTGCCGCGTTTGAATTCCGCTTTA
TCGGCGGTTCGATGGGTTCGGTTGTGGGCGAGCGTTTCGTACAGGGTGTC
CGCCGTGCGGTTGCCGATAATTGTCCGTTTGTCTGTGTGGCGGCTTCCGG
CGGCGCGCGTATGCAGGAGGGTGTAAACTCGCTGATGCAGATGACGAAAA
CCAGTGCCGCGCTGCATTTGCTGACGGAAAAACGCCTGCCGTTTATATCG
GTGTTGACCGATCCGACTATGGGCGGCGTATCTGCCAGCTTCGCATTTTT
AGGCGATGTCGTGCTTGCCGAACCGAACGCGCTGATCGGTTTTGCCGGTC
CGCGCGTGATTGAGCAGACGGTGCGCGAAACGCTGCCGGAAGGCTTCCAA
CGCGCCGAGTTTCTGCTGGAAAAAGGCGCGATCGACCAGATTGTCGACCG
CCGCGATATGAAGCGGCGCATCAGTGATTTGATTACGCTGTTGTGCCGTC
AGGACAAAGTTTCCGCCACC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy