Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR0211 IGR0205 IGR0210.1 IGR0208 IGR0206 IGR0209 IGR0202 IGR0210 IGR0201 IGR0203 IGR0204 IGR0207 IGR0212 tpn, - NG0253 cnp1, - NG0250 NG0247 NG0244 NG0241 NG0251 NG0246 NG0252 NG0243 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 pyrC, - NG0255 maeA,mdh, - NG0240 tpn, - NG0253 cnp1, - NG0250 NG0247 NG0244 NG0241 NG0251 NG0246 NG0252 NG0243 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 pyrC, - NG0255 maeA,mdh, - NG0240 Type: direct, Name:  - 119 Type: direct, Name:  - 120 tpn, - NG0253 cnp1, - NG0250 NG0246 NG0252 NG0243 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 pyrC, - NG0255 maeA,mdh, - NG0240 NG0247 NG0244 NG0241 NG0251
* Calculated from Protein Sequence

Gene ID: NG0248

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trpA  

Definition:
tryptophan synthase alpha chain

Gene Start:
248915

Gene Stop:
249697

Gene Length:
783

Molecular Weight*:
27978

pI*:
4.90

Net Charge*:
-6.55

EC:
4.2.1.20  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Hadero,A. and Crawford,I.P. 1986.
Nucleotide sequence of the genes for tryptophan synthase in Pseudomonas aeruginosa.
Mol. Biol. Evol. 3 (3): 191-204.
Medline: 88174343.

Ishida M, Oshima T.
Effective structure of a leader open reading frame for enhancing the expression of GC-rich genes.
J Biochem (Tokyo). 2002 Jul;132(1):63-70.
PMID: 12097161

Yee MC, Horn V, Yanofsky C.
On the role of helix 0 of the tryptophan synthetase alpha chain of Escherichia coli.
J Biol Chem. 1996 Jun;271(25):14754-63.
PMID: 8662916

Comment:
Oklahoma ID: NGO.248

For the beta chain, see NG0274. For other trp genes, see NG0261 (trpF), NG0872 (trpE), NG1203 (trpD), NG1204 (trpG), NG1721 (trpC).

Blast Summary:  PSI-Blast Search
NG0248 is orthologously related to CAB84159 Neisseria meningitidis, strain Z2491, a putative tryptophan synthase alpha chain protein: residues 1-261 are 96% similar to residues 1-261 of NG0248.

Numerous significant hits to tryptophan synthase alpha chain in gapped BLAST; e.g. residues 1-261 are 44% similar to gb|AAG03425.1|AE004443_3 tryptophan synthase alpha chain of Pseudomonas aeruginosa, residues 3-261 are 46% similar to 7381257 tryptophan synthase alpha subunit of Azospirillum brasilense, residues 3-261 are 47% similar to gb|AAK25505.1| tryptophan synthase, alpha subunit of Caulobacter crescentus.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0159
COG name: Tryptophan synthase alpha chain
Functional Class:  E
The phylogenetic pattern of COG0159 is amt-yqvcebrhuj----i--
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002028 (Tryptophan synthase alpha chain) with a combined E-value of 2e-48.
    IPB002028A    42-63
    IPB002028B    94-109
    IPB002028C    170-182
    IPB002028D    205-221
    IPB002028E    225-235


ProDom Summary:  Protein Domain Search
Residues 18-235 are 48% similar to a (TRYPTOPHAN SYNTHASE BIOSYNTHESIS LYASE) protein domain (PD001535) which is seen in TRPA_CAUCR.



Paralogs:  Local Blast Search


NG0248 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 261 (E-value = 3.4e-106) place NG0248 in the Trp_syntA family which is described as Tryptophan synthase alpha chain (PF00290)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
9
cleavable N-terminal sequence  
1  
42
non-globular  
206  
261

PDB Hit:
pdb|1GEQ|1GEQ-A ENTROPIC STABILIZATION OF THE TRYPTOPHAN 159.0 7e-40
pdb|1A50|1A50-A CRYSTAL STRUCTURE OF WILD-TYPE TRYPTOPHAN 145.0 8e-36
pdb|1K8X|1K8X-A CRYSTAL STRUCTURE OF ALPHAT183V MUTANT OF 145.0 1e-35
pdb|1A5A|1A5A-A CRYO

Gene Protein Sequence:
MSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGADILELGV
PFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGY
LNPIHKMGYREFAQEAAKAGVDGVLTVDSPIETIDSLYRELKDNEVDCIF
LIAPTTTEDRIKTIAELAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLRQ
YIDIPIGVGFGISNAESARKIGRVAAAIIVGSRIVKEIENNAGNEAAAVG
ALVKELKDAVR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAGAATCCGGCAGGCTTTTGCCGCTTTGGATGGCGGAAAGGCATT
GATTCCCTATATTGCGGTGGGCGACCCCGATATTCGGACAACTTTGGCAT
TGATGCACGGCATGGTTGCAAGCGGTGCGGATATTTTGGAGTTGGGCGTG
CCGTTTTCCGATCCGATGGCGGACGGGCCGGTTATTCAGCGTGCGGCGGA
GCGGGCGTTGGCAAACGGGATTTCGCTGCGCGATGTCTTGGATGTCGTCA
GAAAATTCCGTGAAACCGACACGCAAACGCCGGTTGTTTTGATGGGATAT
TTGAATCCCATACATAAGATGGGTTATCGGGAGTTTGCTCAGGAAGCCGC
AAAGGCGGGGGTGGACGGCGTGTTGACGGTGGATTCCCCCATCGAAACCA
TCGATTCTTTATATCGCGAGCTGAAGGATAACGAGGTCGACTGTATTTTC
CTGATTGCGCCGACGACGACGGAAGACCGTATTAAAACCATTGCCGAGCT
GGCAGGCGGATTTGTCTATTATGTTTCGCTCAAGGGCGTAACGGGCGCGG
CAAGTTTGGATACGGATGAGGTTTCGCGTAAAATAGAGTATTTGCGTCAG
TATATCGATATTCCCATCGGTGTCGGTTTCGGCATCAGCAATGCGGAAAG
CGCGCGCAAAATCGGCCGGGTTGCCGCCGCGATCATTGTCGGCAGCCGGA
TTGTGAAAGAGATTGAAAACAATGCGGGCAACGAGGCTGCCGCCGTCGGT
GCTTTGGTCAAAGAGTTAAAGGATGCCGTGCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy