Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR0211 IGR0205 IGR0210.1 IGR0208 IGR0206 IGR0209 IGR0202 IGR0210 IGR0201 IGR0203 IGR0204 IGR0200 IGR0207 tpn, - NG0253 cnp1, - NG0250 NG0247 NG0244 NG0241 NG0251 NG0246 NG0252 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 maeA,mdh, - NG0240 tpn, - NG0253 cnp1, - NG0250 NG0247 NG0244 NG0241 NG0251 NG0246 NG0252 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 maeA,mdh, - NG0240 Type: direct, Name:  - 119 Type: direct, Name:  - 120 tpn, - NG0253 cnp1, - NG0250 NG0241 NG0246 NG0252 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 trpA, - NG0248 accD, - NG0249 lpxK, - NG0242 maeA,mdh, - NG0240 NG0247 NG0244 NG0251
* Calculated from Protein Sequence

Gene ID: NG0245

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kdsB  

Definition:
3-deoxy-D-manno-octulosonate cytidylyltransferase

Gene Start:
247093

Gene Stop:
247851

Gene Length:
759

Molecular Weight*:
27709

pI*:
6.10

Net Charge*:
-4.87

EC:
2.7.7.38  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Secondary Evidence:
Goldman,R.C., Bolling,T.J., Kohlbrenner,W.E., Kim,Y. and Fox,J.L. 1986. Primary structure of CTP:CMP-3-deoxy-D-manno-octulosonate
cytidylyltransferase (CMP-KDO synthetase) from Escherichia coli. J. Biol. Chem. 261 (34): 15831-15835. Medline: 87057231.


Comment:
Oklahoma ID: NGO.245

Blast Summary:  PSI-Blast Search
NG0245 is orthologously related to AAF41093 Neisseria meningitidis, strain MC58, 3-deoxy-D-manno-octulosonate cytidylyltransferase protein: residues 1-253 are 97% similar to residues 1-253 of NG0245.

Numerous significant hits to 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) (CMP-2-keto-3-deoxyoctulosonic acid synthetase) in gapped BLAST; e.g. residues 4-249 are 52% similar to gb|AAC21736.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase of Haemophilus influenzae Rd, residues 4-248 are 53% similar to gb|AAC74004.1| CTP:CMP-3-deoxy-D-manno-octulosonate transferase of Escherichia coli K12, residues 4-249 are 54% similar to gb|AAF95023.1| 3-deoxy-manno-octulosonate cytidylyltransferase of Vibrio cholerae, residues 4-249 are 53% similar to gb|AAG06367.1|AE004723_11 3-deoxy-manno-octulosonate cytidylyltransferase of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1212
COG name: CMP-2-keto-3-deoxyoctulosonic acid synthetase
Functional Class:  M
The phylogenetic pattern of COG1212 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003329 (Cytidylyltransferase (CMP-NeuAc synthetase)) with a combined E-value of 2.7e-25.
    IPB003329A    7-24
    IPB003329B    46-63
    IPB003329C    210-224


ProDom Summary:  Protein Domain Search
Residues 135-246 are 57% similar to a (3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE) protein domain (PD011218) which is seen in KDSB_ECOLI.

Residues 6-114 are 44% similar to a (SYNTHETASE ACID CYTIDYLYLTRANSFERASE) protein domain (PD007621) which is seen in KDSB_HAEIN.



Paralogs:  Local Blast Search


NG0245 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 243 (E-value = 1.7e-74) place NG0245 in the CTP_transf_3 family which is described as Cytidylyltransferase (PF02348)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1GQ9|1GQ9-A THE STRUCTURE OF 154.0 2e-38

Gene Protein Sequence:
MTEFVVLIPARLDSSRLPGKALADIHGKPMVVRVAEQAAKSKAARVVVAT
DHPDIQTACQAHGIEVVMTSNRHESGTTRLAEAAAALKLPPHLIVVNVQG
DEPLIAPELIDRTAEVLVENNVQMATAGHELHDFDELMNPNAVKVVLDKN
GNAIYFSRAPIPYPRDAMRAGKREMPSETAVLRHIGIYAYRVGFLQRYAE
MSVSPLETIESLEQLRVLWHGYPIAVETAKEAPAAGVDTQEDLDRVRAVF
QTV

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGAATTCGTCGTATTGATTCCGGCGCGGCTGGATTCGTCGCGCCT
GCCCGGAAAAGCCTTGGCGGACATTCACGGCAAACCGATGGTCGTGCGCG
TTGCCGAACAGGCGGCAAAAAGCAAAGCCGCGCGCGTCGTCGTCGCCACC
GATCATCCCGACATTCAGACGGCCTGTCAGGCGCACGGTATCGAAGTCGT
CATGACTTCAAACCGGCACGAAAGCGGCACGACGCGCCTTGCCGAAGCCG
CCGCCGCGCTGAAGCTGCCGCCGCATTTGATTGTTGTGAACGTACAGGGC
GACGAGCCGCTGATTGCCCCCGAACTCATCGACCGCACCGCCGAAGTACT
CGTCGAAAACAACGTCCAAATGGCGACCGCCGGCCACGAATTGCACGATT
TCGACGAATTGATGAATCCCAATGCCGTCAAAGTCGTCCTCGACAAAAAC
GGCAACGCCATCTACTTCAGCCGTGCCCCGATTCCCTATCCGCGCGATGC
GATGCGTGCCGGAAAACGCGAAATGCCGTCTGAAACCGCCGTCCTACGCC
ATATCGGCATTTACGCCTACCGCGTCGGCTTCCTGCAACGCTATGCCGAA
ATGAGCGTCTCGCCGCTGGAAACCATCGAATCGCTGGAACAACTGCGCGT
CCTGTGGCACGGCTACCCCATCGCCGTCGAAACCGCCAAAGAAGCCCCCG
CCGCCGGTGTGGATACGCAGGAAGATTTGGACAGGGTTCGCGCTGTATTT
CAGACCGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy