Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR0205 IGR0206 IGR0198 IGR0202 IGR0199 IGR0201 IGR0196 IGR0197 IGR0203 IGR0200 IGR0204 IGR0207 ampD, - NG0237 NG0236 ligA, - NG0235 NG0247 NG0244 NG0241 NG0246 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 NG0238 lpxK, - NG0242 maeA,mdh, - NG0240 ampD, - NG0237 NG0236 ligA, - NG0235 NG0247 NG0244 NG0241 NG0246 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 NG0238 lpxK, - NG0242 maeA,mdh, - NG0240 ampD, - NG0237 NG0236 ligA, - NG0235 NG0241 NG0246 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 NG0238 lpxK, - NG0242 maeA,mdh, - NG0240 NG0247 NG0244
* Calculated from Protein Sequence

Gene ID: NG0240

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
maeA  mdh  

Definition:
malate dehydrogenase/oxidoreductase

Gene Start:
243240

Gene Stop:
244517

Gene Length:
1278

Molecular Weight*:
45984

pI*:
5.10

Net Charge*:
-9.37

EC:
1.1.1.38  

Functional Class:
Central intermediary metabolism; Pyruvate metabolism  
Energy metabolism; TCA cycle  

Pathway: pathway table
Pyruvate metabolism

Secondary Evidence:
van der Rest ME, Frank C, Molenaar D.
Functions of the membrane-associated and cytoplasmic malate dehydrogenases in the citric acid cycle of Escherichia coli.
J Bacteriol. 2000 Dec;182(24):6892-9.
PMID: 11092847

Molenaar D, van der Rest ME, Drysch A, Yucel R.
Functions of the membrane-associated and cytoplasmic malate dehydrogenases in the citric acid cycle of Corynebacterium
glutamicum.
J Bacteriol. 2000 Dec;182(24):6884-91.
PMID: 11092846

Comment:
Oklahoma ID: NGO.240

Supplemented by NG1980 (mqo) under certain conditions.

Blast Summary:  PSI-Blast Search
NG0240 is orthologously related to CAB84150 Neisseria meningitidis, strain Z2491, a putative malate oxidoreductase protein: residues 1-426 are 98% similar to residues 1-426 of NG0240.

Numerous significant hits in gapped BLAST; e.g. residues 1-424 are 68% similar to dbj|BAB36748.1| putative multimodular enzyme of Escherichia coli O157:H7, residues 1-424 are 68% similar to dbj|BAA16338.1| putative malate oxidoreductase (NAD) (malic enzyme) of Escherichia coli, residues 1-424 are 71% similar to gb|AAC22896.1| malate oxidoreductase, putative of Haemophilus influenzae Rd.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0281
COG name: Malic enzyme
Functional Class:  C
The phylogenetic pattern of COG0281 is a--ky-vcEBrh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001891 (Malic enzymes) with a combined E-value of 1.6e-13.
    IPB001891E    137-187
    IPB001891F    194-203
    IPB001891G    214-225
    IPB001891J    311-345
    IPB001891K    377-407
***** IPB002505 (Phosphate acetyl/butaryl transferase) with a combined E-value of 1.3e-12.
    IPB002505A    66-100


ProDom Summary:  Protein Domain Search
Residues 5-68 are 75% similar to a (OXIDOREDUCTASE ENZYME MALIC MALATE) protein domain (PD005834) which is seen in P76558_ECOLI.

Residues 69-417 are 70% similar to a (ENZYME OXIDOREDUCTASE MALIC MALATE) protein domain (PD001213) which is seen in MAOX_HAEIN.



Paralogs:  Local Blast Search


NG0240 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 19 to 161 (E-value = 1.5e-79) place NG0240 in the malic family which is described as Malic enzyme, N-terminal domain (PF00390)
Residues 163 to 402 (E-value = 1e-130) place NG0240 in the Malic_M family which is described as Malic enzyme, NAD binding domain (PF03949)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
61  
140
transmembrane  
66  
82

PDB Hit:
pdb|1GQ2|1GQ2-A MALIC ENZYME FROM PIGEON LIVER 84.7 3e-17
pdb|1EFK|1EFK-A STRUCTURE OF HUMAN MALIC ENZYME IN COMPLEX WITH 71.0 4e-13
pdb|1GZ4|1GZ4-A MOLECULAR MECHANISM OF THE REGULATION OF HUMAN 71.0 4e-13
pdb|1DO8|1DO8-A CRYS

Gene Protein Sequence:
MENSLKEAALKFHELPVPGKISVTPTKSLATDKDLALAYSPGVAAPCMEI
HADPQNAYKYTGKGNLVAVISNGTAVLGLGDIGALAGKPVMEGKGVLFKK
FAGVDVFDIEIDEKDPQKLVDIIAALEPTFGGINLEDIKAPECFYIEREL
RKRCKIPVFHDDQHGTAIITAAAVLNALRYTGRKIEEATLVCSGAGAAAI
ACLNQLLDLGLKRENVTVCDSKGVIYQTREDKDRMDESKKFYAVEDNGRR
VLADAVKGKDIFLGLSGANLLTPEMLNTMNEKPIVFAMANPNPEILPPLA
KETRPDVVIGTGRSDFPNQVNNVLCFPFIFRGALDVGATTINEEMKRACV
YALADLAMEEVTEEVVAAYGKKFEFGAEYLIPTPFDSRLLPRVATAAAKA
AMESGVATRPIADLEAYAAKLGEWKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAACTCATTGAAAGAAGCCGCCCTCAAGTTCCACGAATTACCCGT
TCCGGGCAAAATTTCCGTTACCCCGACCAAATCTCTGGCGACCGACAAAG
ATTTGGCGTTGGCGTACTCTCCGGGCGTAGCCGCCCCCTGTATGGAAATC
CATGCCGATCCGCAAAATGCCTACAAATACACCGGCAAAGGCAACTTGGT
CGCCGTCATTTCCAACGGTACGGCCGTTTTGGGCTTGGGCGACATCGGCG
CGCTGGCGGGCAAACCCGTGATGGAAGGCAAAGGCGTATTGTTCAAAAAA
TTCGCCGGTGTGGACGTGTTCGACATCGAAATCGACGAAAAAGACCCGCA
AAAACTGGTGGACATCATCGCCGCTTTGGAGCCGACTTTCGGCGGCATCA
ACCTCGAAGACATCAAAGCACCCGAGTGTTTTTACATCGAACGCGAATTA
CGCAAACGCTGCAAAATCCCCGTATTTCATGATGACCAGCACGGCACGGC
CATCATTACCGCCGCCGCCGTATTGAACGCCCTGCGTTATACCGGCCGTA
AAATCGAAGAAGCGACTTTGGTGTGCTCCGGCGCAGGTGCCGCCGCGATT
GCCTGCCTGAACCAACTGCTGGATTTGGGCTTGAAACGTGAAAACGTAAC
CGTTTGCGACTCCAAAGGCGTGATTTACCAAACCCGCGAAGACAAAGACC
GCATGGACGAATCCAAAAAATTCTACGCCGTTGAAGACAACGGCCGGCGC
GTACTTGCCGATGCGGTTAAAGGCAAAGACATCTTCTTGGGCCTCTCCGG
CGCAAACCTGCTGACGCCTGAAATGTTGAACACGATGAACGAAAAACCCA
TCGTGTTCGCCATGGCCAACCCGAATCCGGAAATCCTGCCGCCGCTGGCG
AAAGAAACCCGTCCGGACGTGGTTATCGGTACCGGCCGCTCCGACTTCCC
GAACCAAGTGAACAACGTATTGTGCTTCCCGTTCATCTTCCGGGGCGCGT
TGGATGTCGGCGCAACCACCATCAACGAAGAAATGAAACGCGCCTGCGTG
TATGCTTTGGCAGATTTGGCGATGGAAGAAGTAACCGAAGAAGTGGTTGC
CGCTTACGGTAAGAAATTCGAATTCGGCGCGGAATACCTGATTCCTACTC
CGTTCGATTCCCGCCTGCTGCCTCGCGTCGCTACGGCTGCCGCCAAAGCA
GCGATGGAAAGCGGCGTGGCAACCCGTCCGATTGCAGATTTGGAAGCTTA
CGCTGCCAAGTTGGGCGAATGGAAGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy