Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0198 IGR0202 IGR0199 IGR0201 IGR0196 IGR0197 IGR0203 IGR0204 IGR0200 ampD, - NG0237 NG0236 ligA, - NG0235 NG0244 NG0241 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 NG0238 lpxK, - NG0242 maeA,mdh, - NG0240 ampD, - NG0237 NG0236 ligA, - NG0235 NG0244 NG0241 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 NG0238 lpxK, - NG0242 maeA,mdh, - NG0240 ampD, - NG0237 NG0236 ligA, - NG0235 NG0241 NG0243 tmpK,tmk, - NG0239 kdsB, - NG0245 NG0238 lpxK, - NG0242 maeA,mdh, - NG0240 NG0244
* Calculated from Protein Sequence

Gene ID: NG0239

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tmpK  tmk  

Definition:
thymidylate kinase (dTMP kinase)

Gene Start:
242398

Gene Stop:
243015

Gene Length:
618

Molecular Weight*:
22942

pI*:
5.00

Net Charge*:
-7.12

EC:
2.7.4.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Chenal-Francisque,V., Tourneux,L., Carniel,E., Christova,P., de la
Sierra,I.L., Barzu,O. and Gilles,A.M. 1999.
The highly similar TMP kinases of Yersinia pestis and Escherichia coli differ markedly in their AZTMP phosphorylating activity.
Eur. J. Biochem. 265 (1): 112-119.
Medline: 99421723.

Lavie,A., Ostermann,N., Brundiers,R., Goody,R.S., Reinstein,J.,
Konrad,M. and Schlichting,I.
Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase
Proc. Natl. Acad. Sci. U.S.A. 95 (24), 14045-14050 (1998)
M: 99045634



Comment:
Oklahoma ID: NGO.239

Blast Summary:  PSI-Blast Search
NG0239 is orthologously related to AAF41088 Neisseria meningitidis, strain MC58, a thymidylate kinase protein: residues 1-206 are 98% similar to residues 1-206 of NG0239.

Numerous significant hits to thymidylate kinase (dTMP kinase) in gapped BLAST; e.g. residues 5-200 are 52% similar to gb|AAG06350.1|AE004722_6 thymidylate kinase of Pseudomonas aeruginosa, residues 4-187 are 46% similar to gb|AAG42374.1|AF294440_6 thymidylate kinase of Xanthomonas albilineans, residues 1-200 are 42% similar to gb|AAC18855.1| thymidylate kinase of Yersinia pestis.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0125
COG name: Thymidylate kinase
Functional Class:  F
The phylogenetic pattern of COG0125 is AmTkyqvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000062 (Thymidylate kinase) with a combined E-value of 4.9e-31.
    IPB000062A    5-18
    IPB000062B    60-73
    IPB000062C    81-104
    IPB000062D    128-144


ProDom Summary:  Protein Domain Search
Residues 1-196 are 42% similar to a (THYMIDYLATE KINASE DTMP TRANSFERASE) protein domain (PD002766) which is seen in KTHY_YERPE.



Paralogs:  Local Blast Search


NG0239 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 196 (E-value = 1.8e-57) place NG0239 in the Thymidylate_kin family which is described as Thymidylate kinase (PF02223)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|4TMK|4TMK-A COMPLEX OF E. COLI THYMIDYLATE KINASE WITH THE 144.0 1e-35
pdb|1E9F|1E9F-A MUTANT HUMAN THYMIDYLATE KINASE COMPLEXED WITH 46.5 4e-06
pdb|1TMK|1TMK-A YEAST THYMIDYLATE KINASE COMPLEXED WITH 45.7 7e-06
pdb|1E9C|1E9C-A MUTA

Gene Protein Sequence:
MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALR
EILLNPETKAGLRAETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDAT
FAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMARIGQARE
KDRFEQEQADFFMRVRGVYLDRAAACPERYAVIDSNRSLDEVRNSIEKVL
DGHFGC

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCGCAATTCATCACTTTGGACGGCATAGACGGTGCCGGAAAATC
CACCAACCTTGCCGTCATCAAGGCATGGTTTGAACGGAGGGGGCTGCCCG
TGCTGTTCACGCGCGAGCCGGGCGGAACGCCGGTCGGTGAGGCCTTGCGC
GAAATCCTGCTCAACCCTGAAACCAAAGCCGGTTTGCGTGCGGAAACACT
GATGATGTTCGCCGCGCGTATGCAGCACATCGAGGAAGTCATCCTGCCCG
CGCTTTCAGACGGCATCCATGTCGTGTCCGACCGTTTTACCGATGCGACC
TTCGCCTATCAGGGCGGCGGGCGGGGGATGCCGTCTGAAGACATTGAAAT
TTTGGAACATTGGGTGCAGGGCGGTTTGCGCCCCGATTTGACCCTGCTGT
TGGATGTGCCGCTGGAAGTATCGATGGCGCGTATCGGACAGGCGCGCGAG
AAAGACCGGTTCGAGCAGGAGCAGGCGGATTTCTTTATGCGTGTGCGCGG
CGTTTATCTCGACCGAGCCGCCGCCTGTCCCGAACGGTACGCCGTTATCG
ACAGTAACCGCAGCTTGGATGAAGTCAGAAACAGCATAGAAAAAGTGTTG
GACGGACATTTCGGCTGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy