Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0188 IGR0191 IGR0186 IGR0190 IGR0195 IGR0192 IGR0193 IGR0189 IGR0194 IGR0187 NG0232 nspA, - NG0233 apaH, - NG0231 hemN, - NG0234 trkH, - NG0230 ligA, - NG0235 NG0227 NG0228 NG0229 NG0226 mafB, - NG0225 NG0232 nspA, - NG0233 apaH, - NG0231 hemN, - NG0234 trkH, - NG0230 ligA, - NG0235 NG0227 NG0228 NG0229 NG0226 mafB, - NG0225 NG0232 nspA, - NG0233 apaH, - NG0231 hemN, - NG0234 trkH, - NG0230 ligA, - NG0235 NG0228 NG0229 NG0226 mafB, - NG0225 NG0227
* Calculated from Protein Sequence

Gene ID: NG0231

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
apaH  

Definition:
bis(5'-nucleosyl)-tetraphosphatase

Gene Start:
233786

Gene Stop:
232959

Gene Length:
828

Molecular Weight*:
30865

pI*:
7.60

Net Charge*:
1.79

EC:
3.6.1.41  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Blanchin-Roland,S., Blanquet,S., Schmitter,J.M. and Fayat,G. 1986. The gene for Escherichia coli diadenosine tetraphosphatase is located immediately clockwise to folA and forms an operon with ksgA. Mol. Gen. Genet. 205 (3): 515-522. Medline: 87172305.
Guranowski,A., Jakubowski,H. and Holler,E. 1983. Catabolism of diadenosine 5',5''-P1,P4-tetraphosphate in procaryotes. Purification and properties of diadenosine 5',5''-P1,P4-tetraphosphate (symmetrical) pyrophosphohydrolase from Escherichia coli K12. J. Biol. Chem. 258 (24): 14784-14789. Medline: 84087863.


Comment:
Oklahoma ID: NGO.231c

Blast Summary:  PSI-Blast Search
NG0231 is orthologously related to CAB84141 Neisseria meningitidis, strain Z2491, a putative bis(5'-nucleosyl)-tetraphosphatase protein: residues 1-276 are 96% similar to residues 1-276 of NG0231.

Numerous significant hits to bis(5'-nucleosyl)-tetraphosphatase (diadenosine tetraphosphatase) (AP4A hydrolase) (diadenosine 5',5"'-P1,P4-tetraphosphate pyrophosphohydrolase) in gapped BLAST; e.g. residues 1-256 are 48% similar to gb|AAF93614.1| bis(5`-nucleosyl)-tetraphosphatase of Vibrio cholerae, residues 1-259 are 47% similar to gb|AAG03979.1|AE004495_3 bis(5'-nucleosyl)-tetraphosphatase of Pseudomonas aeruginosa, residues 1-259 are 46% similar to gb|AAG54354.1|AE005182_3 diadenosine tetraphosphatase of Escherichia coli O157:H7 EDL933.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0639
COG name: Diadenosine tetraphosphatase and related serine/threonine protein phosphatases
Functional Class:  T
The phylogenetic pattern of COG0639 is Am-KY-VcEb-H---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 141-259 are 40% similar to a (DIADENOSINE TETRAPHOSPHATASE) protein domain (PD013620) which is seen in APAH_ECOLI.

Residues 6-125 are 54% similar to a (PROTEIN PHOSPHATASE SERINE/THREONINE) protein domain (PD000252) which is seen in APAH_ECOLI.

Residues 5-125 are 45% similar to a (PUTATIVE DIADENOSINE TETRAPHOSPHATASE) protein domain (PD176256) which is seen in O69115_BURPS.



Paralogs:  Local Blast Search


NG0231 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 229 (E-value = 3.7e-07) place NG0231 in the Metallophos family which is described as Calcineurin-like phosphoesterase (PF00149)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1G5B|1G5B-A BACTERIOPHAGE LAMBDA SER/THR PROTEIN 43.0 7e-05
pdb|1FJM|1FJM-A PROTEIN SERINE/THREONINE PHOSPHATASE-1 (ALPHA 97.1 3e-21
pdb|1IT6|1IT6-A CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN 97.1 3e-21
pdb|1M63|1M63-A CRYS

Gene Protein Sequence:
MAHYAIGDIQGCFDELTALLGKIGFNHGTDTLWLTGDIVNRGPKSLETLQ
FCIRHENSVQIVLGNHDLYLLAVGCGEGALKRSDTIEPILKHPDGGKMLD
WLRAQPLLIREGGRVMIHAGILPQWRIAKAESLAGEAEAELRGKKYVKFF
SKMYGNKPAAWDEGLEGYARLRFIVNAFTRMRALTFKNELDFDYKSTVKK
MPPYLRPWFKAPDRQNLDHTIIFGHWSSLGYTNADNVISLDTGALWGGQL
TAVNLETEEITQVQAAGGIDWKSFAK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACATTACGCAATCGGCGACATCCAAGGCTGTTTCGACGAACTGAC
CGCGCTGCTCGGCAAAATCGGCTTCAACCACGGCACGGACACCCTCTGGC
TGACGGGCGACATCGTCAACCGCGGCCCGAAATCCCTCGAAACGCTGCAA
TTCTGCATCCGGCACGAAAACAGCGTGCAAATCGTCCTCGGCAACCACGA
CCTGTACCTGCTCGCCGTCGGCTGCGGCGAAGGCGCGCTCAAACGCAGCG
ACACAATCGAACCCATACTCAAACACCCCGACGGCGGAAAAATGCTCGAC
TGGCTGCGCGCGCAACCGCTTTTGATACGCGAGGGCGGCCGCGTGATGAT
ACACGCCGGCATCCTGCCGCAATGGCGCATAGCCAAAGCCGAATCGCTCG
CCGGAGAAGCCGAAGCCGAACTGCGCGGCAAAAAATACGTCAAATTCTTC
TCCAAAATGTACGGCAACAAACCGGCCGCATGGGACGAAGGTTTGGAAGG
CTATGCCCGCCTGCGCTTCATCGTCAACGCCTTCACGCGGATGCGCGCCC
TGACCTTTAAAAACGAACTGGATTTCGACTACAAATCCACAGTGAAAAAA
ATGCCGCCTTACCTGCGCCCGTGGTTCAAAGCCCCCGATCGGCAAAACCT
CGACCACACCATCATCTTCGGACACTGGTCCTCGCTGGGCTACACGAATG
CCGACAACGTCATCTCGCTGGACACCGGCGCGCTGTGGGGCGGGCAGCTG
ACCGCCGTCAACCTCGAAACGGAAGAAATTACCCAAGTCCAAGCCGCCGG
CGGCATAGACTGGAAAAGCTTCGCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy