Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 IGR0188 IGR0181 IGR0186 IGR0182 IGR0190 IGR0180 IGR0184 IGR0183 IGR0189 IGR0179 IGR0187 IGR0185 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 trkH, - NG0230 NG0227 NG0228 NG0229 NG0226 mafB, - NG0225 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 trkH, - NG0230 NG0227 NG0228 NG0229 NG0226 mafB, - NG0225 ntpA, - NG0224 ppa, - NG0223 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 trkH, - NG0230 NG0222 NG0221 NG0218 NG0222 NG0228 NG0229 NG0226 mafB, - NG0225 NG0227
* Calculated from Protein Sequence

Gene ID: NG0224

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ntpA  

Definition:
nucleoside triphosphate pyrophosphohydrolase (Na(+)-translocating ATPase)

Gene Start:
226836

Gene Stop:
226381

Gene Length:
456

Molecular Weight*:
17508

pI*:
6.60

Net Charge*:
-1.31

EC:
3.6.1.-  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Takase K, Kakinuma S, Yamato I, Konishi K, Igarashi K, Kakinuma Y.
Sequencing and characterization of the ntp gene cluster for vacuolar-type Na(+)-translocating ATPase of Enterococcus hirae.
J Biol Chem. 1994 Apr;269(15):11037-44.
PMID: 8157629

Murata T, Yoshikawa Y, Hosaka T, Takase K, Kakinuma Y, Yamato I, Kikuchi T.
Nucleotide-Binding Sites in V-Type Na(+)-ATPase from Enterococcus hirae.
J Biochem (Tokyo). 2002 Nov;132(5):789-94.
PMID: 12417030

Comment:
Oklahoma ID: NGO.224c

Blast Summary:  PSI-Blast Search
NG0224 is orthologously related to CAB84133 Neisseria meningitidis, strain Z2491, a putative nucleoside triphosphate pyrophosphohydrolase protein: residues 1-152 are 94% similar to residues 1-152 of NG0224. NG0224 is orthologously related to AAF4106 Neisseria meningitidis, strain MC58, a dATP pyrophosphohydrolase protein: residues 1-152 are 94% similar to residues 1-152 of NG0224.

Several significant hits in gapped BLAST; e.g. residues 5-142 are 43% similar to gb|AAG56855.1|AE005408_13 dATP pyrophosphohydrolase of Escherichia coli O157:H7 EDL933.




COGS Summary:  COGS Search
BeTs to 9 clades of COG0494
COG name: NTP pyrophosphohydrolases (MutT family) including oxidative damage repair enzymes
Functional Class:  L,R
The phylogenetic pattern of COG0494 is a-T-YqvCEBRHuj---linx
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
***** PR01404 (DATP pyrophosphohydrolase signature) with a combined E-value of 3.5e-12.
    PR01404B    23-44
    PR01404C    72-91
    PR01404E    129-142
***** IPB000086 (NUDIX hydrolase) with a combined E-value of 1.8e-10.
    IPB000086    36-62


ProDom Summary:  Protein Domain Search
Residues 8-63 are 54% similar to a (PROTEIN HYDROLASE MUTT MUTATOR PYROPHOSPHOHYDROLASE) protein domain (PD000653) which is seen in NTPA_ECOLI.



Paralogs:  Local Blast Search


NG0224 is paralogously related to NG1334 (MutT-like protein; invasion protein) (5e-05) and NG1506 (NTP pyrophosphohydrolase (MutT)) (3e-04).


Pfam Summary:  Pfam Search
Residues 9 to 149 (E-value = 3.9e-25) place NG0224 in the NUDIX family which is described as NUDIX domain (PF00293)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
50
transmembrane  
11  
27

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPMAKPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEPGETVA
QTARREVWEETGILLEDGQLQDRHDSTVYEIYHHWRHRYPKGVFENREHV
FRAEIPRDTPVVLQPEEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLG
KR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGATGGCAAAACCGCTCAAATACCCCGTTTCCGCACTGGTCGTCCT
TTATAGCGGGGACGGCGGCATCCTGCTCATCGAACGCACGCATCCGAAAG
GATTTTGGCAGTCGGTAACCGGCAGCCTCGAACCGGGCGAAACCGTCGCC
CAAACGGCAAGGCGCGAAGTTTGGGAAGAAACCGGCATCCTGCTGGAGGA
CGGGCAGCTCCAAGACCGGCACGACAGCACGGTTTACGAAATCTACCACC
ACTGGCGGCACCGCTACCCCAAAGGCGTGTTTGAAAACCGCGAACACGTC
TTCCGGGCCGAAATCCCGCGCGATACGCCCGTCGTCCTGCAACCCGAGGA
ACACGTCTCCTACGGCTGGTTCGGCTTGGAAGAAGCGGCGGAAAAAGTGT
TTTCCCCGTCCAACAGGCGCGCGATTTTGGAACTGGGCAGGTTTTTGGGC
AAACGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy