Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 IGR0188 IGR0181 IGR0186 IGR0182 IGR0180 IGR0184 IGR0183 IGR0189 IGR0179 IGR0187 IGR0185 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 NG0227 NG0228 NG0226 mafB, - NG0225 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 NG0227 NG0228 NG0226 mafB, - NG0225 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 NG0222 NG0222 NG0228 NG0226 mafB, - NG0225 NG0227
* Calculated from Protein Sequence

Gene ID: NG0223

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ppa  

Definition:
inorganic pyrophosphatase

Gene Start:
226276

Gene Stop:
225746

Gene Length:
531

Molecular Weight*:
19752

pI*:
4.60

Net Charge*:
-9.32

EC:
3.6.1.1  

Functional Class:
Central intermediary metabolism; Phosphorus compounds  

Pathway: pathway table
Oxidative phosphorylation

Secondary Evidence:
Meyer,W., Moll,R., Kath,T. and Schafer,G. 1995.
Purification, cloning, and sequencing of archaebacterial pyrophosphatase from the extreme thermoacidophile Sulfolobus acidocaldarius.
Arch. Biochem. Biophys. 319 (1): 149-156.
Medline: 95289717.

Leppanen,V.M., Nummelin,H., Hansen,T., Lahti,R., Schafer,G. and
Goldman,A. 1999.
Sulfolobus acidocaldarius inorganic pyrophosphatase: structure, thermostability, and effect of metal ion in an archael pyrophosphatase.
Protein Sci. 8 (6): 1218-1231.
Medline: 99313443.


Comment:
Oklahoma ID: NGO.223c

Blast Summary:  PSI-Blast Search
NG0223 is orthologously related to AAF41064 Neisseria meningitidis, strain MC58, an inorganic pyrophosphatase protein: residues 1-177 are 98% similar to residues 1-177 of NG0223.

Numerous significant hits to inorganic pyrophosphatase (pyrophosphate phospho-hydrolase) in gapped BLAST; e.g. residues 1-176 are 84% similar to gb|AAC21798.1| inorganic pyrophosphatase of Haemophilus influenzae Rd, residues 18-174 are 41% similar to gb|AAC02428.1| inorganic pyrophosphatase of Legionella pneumophila.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0221
COG name: Inorganic pyrophosphatase
Functional Class:  C
The phylogenetic pattern of COG0221 is --tkYq-ce-rhujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001596 (Inorganic pyrophosphatase) with a combined E-value of 2.4e-27.
    IPB001596A    44-97
    IPB001596B    132-143


ProDom Summary:  Protein Domain Search
Residues 18-173 are 76% similar to a (INORGANIC PYROPHOSPHATASE HYDROLASE) protein domain (PD002014) which is seen in IPYR_HAEIN.



Paralogs:  Local Blast Search


NG0223 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 19 to 175 (E-value = 1.5e-88) place NG0223 in the Pyrophosphatase family which is described as Inorganic pyrophosphatase (PF00719)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QEZ|1QEZ-A SULFOLOBUS ACIDOCALDARIUS INORGANIC 99.5 4e-22
pdb|1INO|1INO 89.3 4e-19
pdb|1MJX|1MJX-A STRUCTURE OF INORGANIC PYROPHOSPHATASE MUTANT 89.3 4e-19
pdb|1I40|1I40-A STRUCTURE OF INORGANIC PYROPHOSPHATASE 8

Gene Protein Sequence:
MADFNQILTPGDVDGGIINVVNEIPAGSNHKIEWNRKLAAFQLDRIEPAI
FAKPTNYGFIPQTLDEDGDELDVLLVTEQPLATGVFLEARVIGVMKFVDD
GEVDDKIVCVPADDRNNGNAYKTLSDLPQQLIKQIEFHFNHYKDLKKAGT
TKVESWGGAEEAKKVIKESIERWNKQA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGACTTCAACCAAATCCTGACCCCGGGCGACGTGGACGGCGGCAT
CATCAACGTCGTCAACGAAATCCCCGCCGGCAGCAACCACAAAATCGAGT
GGAACCGCAAACTCGCCGCATTCCAACTCGACCGCATCGAACCCGCCATC
TTCGCCAAACCGACCAACTACGGCTTCATCCCCCAAACTTTGGACGAAGA
CGGCGATGAATTGGACGTGTTGCTCGTTACCGAACAACCTCTGGCAACCG
GCGTATTCTTGGAAGCGCGCGTTATCGGCGTGATGAAATTCGTCGACGAC
GGCGAAGTGGACGACAAAATCGTCTGCGTACCTGCCGACGACCGCAATAA
CGGCAACGCCTACAAAACTTTGTCCGATTTGCCGCAACAGCTCATCAAAC
AAATCGAGTTCCACTTCAACCACTACAAAGACCTGAAAAAAGCGGGTACG
ACCAAAGTCGAATCCTGGGGCGGTGCGGAAGAAGCGAAAAAAGTCATCAA
AGAATCCATCGAACGTTGGAACAAACAGGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy