Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 IGR0181 IGR0186 IGR0182 IGR0178 IGR0180 IGR0184 IGR0183 IGR0179 IGR0185 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 fbpB, - NG0216 NG0226 mafB, - NG0225 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 fbpB, - NG0216 NG0226 mafB, - NG0225 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 argH, - NG0219 fbpB, - NG0216 NG0222 NG0222 NG0226 mafB, - NG0225
* Calculated from Protein Sequence

Gene ID: NG0220

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
galU  

Definition:
UTP--glucose-1-phosphate uridylyltransferase

Gene Start:
224782

Gene Stop:
223916

Gene Length:
867

Molecular Weight*:
31983

pI*:
6.40

Net Charge*:
-2.48

EC:
2.7.7.9  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Galactose metabolism
Nucleotide sugars metabolism
Pentose and glucuronate interconversions
Starch and sucrose metabolism

Secondary Evidence:
Wei,C.L., Lin,N.T., Weng,S.F. and Tseng,Y.H. 1996. The gene encoding UDP-glucose pyrophosphorylase is required for the
synthesis of xanthan gum in Xanthomonas campestris. Biochem. Biophys. Res. Commun. 226 (3): 607-612. Medline: 96428562.


Comment:
For other 'gal' genes see NG1896 (galE).

Oklahoma ID: NGO.220c

Blast Summary:  PSI-Blast Search
NG0220 is orthologously related to AAF41061 Neisseria meningitidis, strain MC58, a UTP--glucose-1-phosphate uridylyltransferase protein: residues 1-289 are 98% similar to residues 1-289 of NG0220.

Numerous significant hits to UTP-glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (alpha-D-glucosyl-1-phosphate uridylyltransferase) (uridine diphosphoglucose pyrophosphorylase) in gapped BLAST; e.g. residues 1-283 are 60% similar to gb|AAG24457.1|AF312223_1 putative UTP-glucose-1-phosphate uridylyltransferase of Burkholderia pseudomallei, residues 2-283 are 59% similar to
gb|AAB17376.1| UDP-glucose pyrophosphorylase of Xanthomonas campestris.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1210
COG name: UDP-glucose pyrophosphorylase
Functional Class:  M
The phylogenetic pattern of COG1210 is -mt--q--EBrhujgpo----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-137 are 59% similar to a (TRANSFERASE PYROPHOSPHORYLASE PROTEIN BIOSYNTHESIS) protein domain (PD000318) which is seen in GALF_ECOLI.

Residues 83-160 are 45% similar to a (URIDYLYLTRANSFERASE UTP--GLUCOSE-1-PHOSPHATE UDP-GLUCOSE) protein domain (PD105431) which is seen in GALU_PSEAE.

Residues 7-75 are 49% similar to a (GALU PUTATIVE UTP-GLUCOSE-1-PHOSPHATE) protein domain (PD105433) which is seen in O05576_MYCTU.

Residues 78-136 are 55% similar to a (TRANSFERASE URIDYLYLTRANSFERASE) protein domain (PD036351) which is seen in O85215_ACTPL.

Residues 160-284 are 44% similar to a (TRANSFERASE PYROPHOSPHORYLASE NUCLEOTIDYLTRANSFERASE) protein domain (PD000406) which is seen in GALU_HAEIN.



Paralogs:  Local Blast Search


NG0220 is paralogously related to NG1898 (glucose-1-phosphate thymidylyltransferase) (9e-10) and NG0060 (sugar-phosphate nucleotidyl transferase (mannose-1-phosphate guanyltransferase-related)) (1e-04).


Pfam Summary:  Pfam Search
Residues 6 to 271 (E-value = 2.4e-16) place NG0220 in the NTP_transferase family which is described as Nucleotidyl transferase (PF00483)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1FXO|1FXO-A THE STRUCTURAL BASIS OF THE CATALYTIC MECHANISM 67.5 3e-12
pdb|1IIM|1IIM-A THYMIDYLYLTRANSFERASE COMPLEXED WITH TTP 66.7 5e-12
pdb|1MP4|1MP4-A W224H VARIANT OF S. ENTERICA RMLA 66.3 6e-12
pdb|1H5S|1H5S-B THYM

Gene Protein Sequence:
MKPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGC
TEMVFVTGRNKRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITC
LYIRQAEALGLGHAVLCARAAIGDEPFAVILADDLIDAPKGALKQMVEVY
GRSGNSILGVETVEPSQTGSYGIVETEQLKQFQRITGIVEKPKPEDAPSN
LAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDHEFVLAHPFEG
TRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCGATAAAAAAAGCCGTCTTCCCCGTTGCAGGGATGGGAACCCG
CTTCCTGCCCGCCACCAAGGCCAACCCGAAAGAAATGCTGCCCATCGTCG
ACAAGCCGCTGATCCAATACGCCGTAGAAGAAGCCGTGGAAGCCGGCTGC
ACGGAAATGGTGTTTGTTACCGGGCGCAACAAGCGCAGCATCGAAGACCA
TTTCGACAAGGCATACGAACTCGAAACTAAGTTGGAAATGCGCCATAAAG
ACAAATTGTTGGAACACGTCCGCAACATCCTGCCGCCGAACATTACCTGC
CTCTACATCCGTCAGGCGGAAGCACTGGGATTGGGACACGCCGTCTTGTG
CGCCCGCGCCGCCATCGGCGACGAACCCTTCGCCGTCATCCTTGCCGACG
ACTTAATCGATGCGCCCAAAGGCGCGCTCAAACAAATGGTCGAAGTGTAC
GGGCGCAGCGGTAACAGCATTTTGGGCGTAGAAACCGTCGAACCGTCGCA
AACCGGCTCATACGGCATCGTCGAAACCGAACAGCTCAAACAGTTCCAAC
GCATTACCGGCATTGTCGAAAAACCCAAGCCCGAAGACGCGCCCTCCAAC
CTTGCCGTTGTCGGACGCTACATCCTCACCCCGCGCATTTTCGACCTTTT
AACCGGCCTGCCGCGCGGCGCGGGCAACGAAATCCAGCTTACAGACGGCA
TCGCCAAGCTGCTCGATCACGAATTTGTCTTGGCGCACCCCTTTGAAGGC
ACGCGCTACGACTGCGGCAGCAAACTCGGCTATCTCGAAGCCACCGTCGC
CTACGGTTTAAAACACCCCGAAACCGGCGAACCCTTCCGCCGCCTTTTGG
AAAAATACCGCACCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy