Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 IGR0181 IGR0177 IGR0182 IGR0178 IGR0180 IGR0184 IGR0183 IGR0179 IGR0185 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 fbpB, - NG0216 mafB, - NG0225 NG0218 ntpA, - NG0224 ppa, - NG0223 NG0221 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 fbpB, - NG0216 mafB, - NG0225 NG0218 ntpA, - NG0224 ppa, - NG0223 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 fbpB, - NG0216 NG0222 NG0221 NG0222 mafB, - NG0225
* Calculated from Protein Sequence

Gene ID: NG0219

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argH  

Definition:
argininosuccinate lyase

Gene Start:
223894

Gene Stop:
222521

Gene Length:
1374

Molecular Weight*:
51299

pI*:
5.50

Net Charge*:
-10.21

EC:
4.3.2.1  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Alanine and aspartate metabolism
Arginine and proline metabolism
Urea cycle and metabolism of amino groups

Secondary Evidence:
Parsot,C., Boyen,A., Cohen,G.N. and Glansdorff,N.
Nucleotide sequence of Escherichia coli argB and argC genes:
comparison of N-acetylglutamate kinase and N-acetylglutamate-gamma-semialdehyde dehydrogenase with homologous
and analogous enzymes
Gene 68 (2), 275-283 (1988)
MEDLINE: 89121510

Troshina O, Hansel A, Lindblad P.
Cloning, characterization, and functional expression in Escherichia coli of argH encoding argininosuccinate lyase in the cyanobacterium Nostoc sp. strain PCC 73102.
Curr Microbiol. 2001 Oct;43(4):260-4.
PMID: 11683360

Auchincloss AH, Loroch AI, Rochaix JD.
The argininosuccinate lyase gene of Chlamydomonas reinhardtii: cloning of the cDNA and its characterization as a selectable shuttle marker.
Mol Gen Genet. 1999 Feb;261(1):21-30.
PMID: 10071206

Comment:
See also: ArgA, NG0027; ArgB, NG0844; ArgC, NG0118; ArgD, NG0646; ArgF, NG1232; ArgG, NG1961; ArgJ, NG1194.

Oklahoma ID: NGO.219c

Blast Summary:  PSI-Blast Search
NG0219 is orthologously related to CAB84128 Neisseria meningitidis, strain Z2491, a putative argininosuccinate lyase protein: residues 1-458 are 94% similar to residues 1-458 of NG0219.

Numerous significant hits to argininosuccinate lyase (arginosuccinase) in gapped BLAST; e.g. residues 3-458 are 66% similar to gb|AAG08648.1|AE004938_10 argininosuccinate lyase of Pseudomonas aeruginosa, residues 4-458 are 52% similar to dbj|BAB06905.1| argininosuccinate lyase of Bacillus halodurans.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0165
COG name: Argininosuccinate lyase
Functional Class:  E
The phylogenetic pattern of COG0165 is amt-yq-cebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000362 (Fumarate lyase) with a combined E-value of 1.2e-14.
    IPB000362A    154-167
    IPB000362B    277-287


ProDom Summary:  Protein Domain Search
Residues 153-428 are 57% similar to a (LYASE BIOSYNTHESIS ARGININOSUCCINATE FUMARATE HYDRATASE) protein domain (PD000660) which is seen in O34858_BACSU.

Residues 6-147 are 54% similar to a (LYASE ARGININOSUCCINATE ARGININE BIOSYNTHESIS) protein domain (PD002682) which is seen in O23637_ARATH.



Paralogs:  Local Blast Search


NG0219 is paralogously related to NG0556 (aspartate ammonia-lyase) (6e-13) and NG1029 (fumarate hydratase (fumarase C)) (9e-12).


Pfam Summary:  Pfam Search
Residues 8 to 302 (E-value = 6.7e-92) place NG0219 in the Lyase_1 family which is described as Lyase (PF00206)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
122  
149

PDB Hit:
pdb|1K7W|1K7W-A CRYSTAL STRUCTURE OF S283A DUCK DELTA 2 377.0 0e+00
pdb|1HY1|1HY1-A CRYSTAL STRUCTURE OF WILD TYPE DUCK DELTA 2 376.0 0e+00
pdb|1AUW|1AUW-A H91N DELTA 2 CRYSTALLIN FROM DUCK 374.0 0e+00
pdb|1AOS|1AOS-A HUMA

Gene Protein Sequence:
MHDKTWSGRFNEPVSELVKQYTASIGFDQRLAEWDIQGSLAHAQMLTRSG
VLSENDLTDIRRGMSEILEEIRSGKIEWPLDLEDVHMNIERRLTDKIGDA
GKRLHTGRSRNDQVATDIRLWLRDQITVIQNLIQNLQTALLDLAEQNAEA
VMPGFTHLQVAQPVSFGHHMLAYVEMLGRDFERMTDCRKRVNRMPLGAAA
LAGTTYPIQREITAELLGFEQICQNSLDAVSDRDFAIEFTAAASLVMVHL
SRLSEELILWMSPRFGFIDIADRFCTGSSIMPQKKNPDVPELVRGKSGRV
IGHLIGLITLMKSQPLAYNKDNQEDKEPLFDTADTLIDTLRIYADMMRGV
TVKPGNMRAAVMQGFATATDLADYLVKKGMPFRDAHEVVAQAVRHADEAG
VDLSELPLEALQGFSKLISDDVYGVLTPEGSLNARNHLGGTAPEQVRLQV
KRWREMSA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACGACAAAACCTGGTCCGGACGTTTCAACGAACCCGTTTCCGAACT
CGTCAAACAATACACCGCCTCCATCGGTTTCGACCAACGCCTTGCCGAAT
GGGACATCCAAGGCTCGCTCGCCCACGCGCAGATGCTGACCCGGTCGGGT
GTGCTGAGTGAAAACGATCTGACCGACATCCGTCGGGGCATGTCGGAAAT
CCTCGAAGAAATCCGCAGCGGCAAAATCGAATGGCCGCTCGATTTGGAAG
ATGTCCACATGAACATCGAACGCCGCCTGACCGACAAAATCGGCGACGCG
GGCAAACGCCTGCACACCGGCCGCAGCCGCAACGACCAAGTCGCCACCGA
CATCCGCCTTTGGCTGCGCGACCAGATTACCGTTATCCAAAACCTGATTC
AAAACCTTCAGACGGCATTATTGGATTTGGCGGAACAAAACGCCGAAGCC
GTCATGCCCGGTTTTACCCATCTGCAAGTCGCCCAGCCGGTCAGCTTCGG
ACACCACATGCTCGCCTACGTCGAAATGCTCGGACGCGATTTCGAACGCA
TGACCGACTGTCGCAAACGCGTCAACCGTATGCCGCTCGGCGCTGCCGCC
CTTGCCGGTACGACCTATCCGATTCAGCGCGAAATCACCGCCGAATTGTT
GGGTTTCGAACAAATCTGCCAGAACTCGCTCGATGCCGTATCCGACCGCG
ATTTTGCCATTGAGTTCACCGCCGCCGCCTCGCTGGTTATGGTTCACTTG
AGCCGCCTGTCTGAAGAATTGATTTTGTGGATGAGTCCGCGTTTCGGCTT
TATCGACATCGCCGACCGCTTCTGTACGGGTTCGTCCATCATGCCGCAAA
AGAAAAACCCCGACGTACCCGAACTCGTGCGCGGTAAATCCGGCCGAGTC
ATCGGACACCTTATCGGCCTGATTACCCTGATGAAATCGCAGCCCTTGGC
ATACAACAAAGACAATCAGGAAGACAAAGAACCGCTGTTTGACACCGCCG
ACACGCTCATCGACACGCTGCGGATTTACGCCGATATGATGCGCGGCGTA
ACCGTCAAACCCGGCAATATGCGCGCCGCCGTGATGCAGGGTTTTGCCAC
CGCCACCGACTTGGCGGATTATCTGGTCAAAAAAGGTATGCCCTTCCGCG
ATGCCCACGAAGTCGTTGCCCAAGCCGTGCGCCACGCCGATGAAGCCGGC
GTTGATTTGAGCGAATTGCCGCTCGAAGCCCTGCAAGGCTTCAGCAAGCT
GATTTCAGACGACGTGTACGGCGTTCTGACACCCGAAGGCAGCCTCAACG
CGCGCAACCACTTGGGCGGCACCGCGCCCGAACAGGTACGCCTCCAAGTC
AAACGCTGGCGGGAAATGTCAGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy