Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0181 IGR0177 IGR0182 IGR0178 IGR0180 IGR0183 IGR0175 IGR0176 IGR0179 NG0218 ppa, - NG0223 NG0221 hisH, - NG0213 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0218 ppa, - NG0223 NG0221 hisH, - NG0213 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0218 ppa, - NG0223 NG0221 hisH, - NG0213 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0222 NG0222
* Calculated from Protein Sequence

Gene ID: NG0217

DNA Molecule Name:
1  

Genbank ID:
1098687

Gene Name:
fbpA  

Definition:
periplasmic iron-binding protein (major ferric iron binding protein precursor) (major iron-regulated protein), ABC solute binding protein

Gene Start:
221728

Gene Stop:
220736

Gene Length:
993

Molecular Weight*:
35826

pI*:
10.40

Net Charge*:
14.46

EC:
3.2.1.8  

Functional Class:
Transport and binding proteins; ABC Superfamily: substrate-binding protein  
Transport and binding proteins; Iron  

Pathway: pathway table

Primary Evidence:
Berish,S.A., Mietzner,T.A., Mayer,L.W., Genco,C.A., Holloway,B.P.
and Morse,S.A. 1990.
Molecular cloning and characterization of the structural gene for the major iron-regulated protein expressed by Neisseria gonorrhoeae.
J. Exp. Med. 171 (5): 1535-1546.
Medline: 90237747.

Adhikari,P., Berish,S.A., Nowalk,A.J., Veraldi,K.L., Morse,S.A. and Mietzner,T.A. 1996.
The fbpABC locus of Neisseria gonorrhoeae functions in the periplasm-to-cytosol transport of iron.
J. Bacteriol. 178 (7): 2145-2149.
Medline: 96178986.

Berish,S.A., Kapczynski,D.R. and Morse,S.A. 1990.
Nucleotide sequence of the Fbp gene from Neisseria meningitidis. Nucleic Acids Res. 18 (15): 4596.
Medline: 90356404.

Secondary Evidence:
Adhikari,P., Kirby,S.D., Nowalk,A.J., Veraldi,K.L., Schryvers,A.B.
and Mietzner,T.A. 1995.
Biochemical characterization of a Haemophilus influenzae periplasmic iron transport operon.
J. Biol. Chem. 270 (42): 25142-25149.
Medline: 96027620.


Comment:
Oklahoma ID: NGO.217c

See ABC Transporters Analysis Section




Blast Summary:  PSI-Blast Search
NG0217 is identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1588872, a predicted fbpA gene (binds iron in a manner similar to transferrin; periplasmic iron-binding protein).

NG0217 is orthologously related to AAF41057 Neisseria meningitidis, strain MC58, a iron(III) ABC transporter, periplasmic binding protein: residues 1-331 are 99% similar to residues 1-331 of NG0217.

Numerous significant hits in gapped BLAST; e.g. residues 6-331 are 73% similar to dbj|BAA21842.1| ferric iron binding protein of Actinobacillus actinomycetemcomitans.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1840
COG name: Thiamine-binding periplasmic proteins
Functional Class:  H
The phylogenetic pattern of COG1840 is ---k---Ce--H-----l---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 23-141 are identical to a (PROTEIN IRON PRECURSOR SIGNAL) protein domain (PD115164) which is seen in Q50964_NEIGO.

Residues 142-319 are identical to a (PROTEIN PRECURSOR PERIPLASMIC SIGNAL) protein domain (PD002666) which is seen in Q50964_NEIGO.



Paralogs:  Local Blast Search


NG0217 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 278 (E-value = 7.9e-21) place NG0217 in the SBP_bac_1 family which is described as Bacterial extracellular solute-binding protein (PF01547)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
22
cleavable N-terminal sequence  
1  
22

PDB Hit:
pdb|1D9Y|1D9Y-A NEISSERIA GONORRHOEAE FERRIC BINDING PROTEIN 610.0 0e+00
pdb|1D9V|1D9V-A HAEMOPHILUS INFLUENZAE FERRIC-BINDING PROTEIN 443.0 0e+00
pdb|1D9Y|1D9Y-A NEISSERIA GONORRHOEAE FERRIC BINDING PROTEIN 564.0 0e+00
pdb|1D9V|1D9V-A HAEM

Gene Protein Sequence:
MKTSIRYALLAAALTAATPALADITVYNGQHKEAAQAVADAFTRATGIKV
KLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPALATLSAANLLEPLPAST
INETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSVLNYATPK
WKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKEYGKPYAKNSVA
LQAVENGEIDAALINNYYWHAFAREKGVQNVHTRLNFVRHRDPGALVTYS
GAAVLKSSQNKDEAKKFVAFLAGKEGQRALTAVRAEYPLNPHVVSTFNLE
PIAKLEAPQVSATTVSEKEHATRLLEQAGMK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACATCTATCCGATACGCACTGCTTGCCGCAGCCCTGACCGCCGC
CACCCCCGCGCTGGCAGACATTACCGTGTACAACGGCCAACACAAAGAAG
CGGCACAAGCCGTTGCAGATGCCTTTACCCGGGCTACCGGCATCAAAGTC
AAACTCAACAGTGCCAAAGGCGACCAGCTTGCCGGCCAAATCAAAGAAGA
AGGCAGCCGAAGCCCCGCCGACGTATTCTATTCCGAACAAATCCCGGCAC
TCGCCACCCTTTCCGCAGCCAACCTCCTAGAGCCCCTGCCCGCCTCCACC
ATCAACGAAACACGCGGCAAAGGCGTGCCGGTTGCCGCCAAAAAAGACTG
GGTGGCACTGAGCGGACGTTCGCGCGTCGTCGTTTACGACACCCGCAAAC
TGTCTGAAAAAGATTTGGAAAAATCCGTCCTGAATTACGCCACGCCGAAA
TGGAAAAACCGCATCGGTTACGTCCCCACTTCCGGCGCGTTCTTGGAACA
GATTGTCGCCATCGTCAAACTGAAAGGCGAAGCGGCCGCATTGAAATGGC
TCAAAGGCCTGAAAGAATACGGCAAGCCTTACGCTAAAAACTCCGTCGCC
CTTCAAGCGGTTGAAAACGGCGAAATCGATGCCGCCCTCATCAACAACTA
CTACTGGCACGCTTTCGCGCGTGAAAAAGGCGTACAAAATGTCCACACCC
GCCTGAATTTCGTCCGCCACAGAGATCCCGGCGCACTCGTTACCTATTCC
GGCGCAGCCGTGTTAAAATCCTCCCAAAACAAGGATGAGGCGAAAAAATT
CGTCGCCTTCCTCGCCGGCAAGGAAGGACAGCGCGCCCTGACCGCCGTCC
GTGCCGAATATCCTTTGAATCCGCACGTGGTATCCACCTTCAATTTGGAA
CCCATCGCCAAGTTGGAAGCACCCCAAGTGTCCGCCACCACTGTTTCCGA
AAAAGAACACGCCACCCGGCTGCTTGAGCAAGCCGGTATGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy