Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0181 IGR0177 IGR0182 IGR0174 IGR0178 IGR0180 IGR0175 IGR0176 IGR0179 NG0218 NG0221 hisH, - NG0213 hisA, - NG0212 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0218 NG0221 hisH, - NG0213 hisA, - NG0212 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0218 hisH, - NG0213 hisA, - NG0212 galU, - NG0220 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0221
* Calculated from Protein Sequence

Gene ID: NG0216

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fbpB  

Definition:
iron-uptake permease inner membrane protein, MSD protein in ABC transport system

Gene Start:
220677

Gene Stop:
219151

Gene Length:
1527

Molecular Weight*:
56305

pI*:
10.50

Net Charge*:
18.20

EC:
3.2.1.8  

Functional Class:
Transport and binding proteins; ABC Superfamily: membrane spanning permease  
Transport and binding proteins; Iron  

Pathway: pathway table

Primary Evidence:
Berish,S.A., Mietzner,T.A., Mayer,L.W., Genco,C.A., Holloway,B.P.
and Morse,S.A. 1990.
Molecular cloning and characterization of the structural gene for the major iron-regulated protein expressed by Neisseria gonorrhoeae.
J. Exp. Med. 171 (5): 1535-1546.
Medline: 90237747.

Adhikari,P., Berish,S.A., Nowalk,A.J., Veraldi,K.L., Morse,S.A. and Mietzner,T.A. 1996.
The fbpABC locus of Neisseria gonorrhoeae functions in the periplasm-to-cytosol transport of iron.
J. Bacteriol. 178 (7): 2145-2149.
Medline: 96178986
.

Comment:
Oklahoma ID: NGO.216c

See ABC Transporters Analysis Section




Blast Summary:  PSI-Blast Search
NG0216 is similar to a previously sequenced N.gonorrhoeae protein in GenBank, AAB63560. Residues 1-511 are 90% similar to residues 1-509 of NG0216.

NG0216 is orthologously related to CAB84124 Neisseria meningitidis, strain Z2491, putative iron-uptake permease inner membrane protein: residues 1-509 are 98% similar to residues 1-509 of NG0216.

Numerous significant hits in gapped BLAST; e.g. residues 7-509 are 71% similar to pir||D64048 iron (III) ABC transporter, permease protein of Haemophilus influenzae (strain Rd KW20).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1178
COG name: Uncharacterized transport system, permease component
Functional Class:  R
The phylogenetic pattern of COG1178 is ---k----e--H-----l---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 472-509 are identical to a (IRONIII-TRANSPORT SYSTEM PERMEASE PROTEIN HITB TRANSPORT) protein domain (PD027964) which is seen in Q50965_NEIGO.

Residues 45-122 are 85% similar to a (TRANSPORT PROTEIN TRANSMEMBRANE PERMEASE MEMBRANE SUGAR) protein domain (PD000737) which is seen in Q50965_NEIGO.

Residues 386-448 are 97% similar to a (TRANSPORT PROTEIN TRANSMEMBRANE PERMEASE MEMBRANE SYSTEM) protein domain (PD000120) which is seen in Q50965_NEIGO.

Residues 36-115 are 38% similar to a (IRONIII-TRANSPORT SYSTEM PERMEASE PROTEIN) protein domain (PD079739) which is seen in SFUB_SERMA.

Residues 233-273 are identical to a (IRONIII-TRANSPORT SYSTEM PERMEASE PROTEIN HITB TRANSPORT) protein domain (PD031197) which is seen in Q50965_NEIGO.

Residues 294-384 are identical to a (IRONIII-TRANSPORT SYSTEM PERMEASE PROTEIN TRANSPORT IRON) protein domain (PD015756) which is seen in Q50965_NEIGO.



Paralogs:  Local Blast Search


NG0216 is paralogously related to NG2078 (ABC transporter, permease protein, MSD protein in ABC transport system) (3e-16), NG0446 (sulfate transport permease protein C) (5e-13), NG0447 (sulfate transport system permease protein) (2e-09), NG0196 (spermidine/putrescine ABC transporter, permease protein) (2e-07), NG2011 (probable amino-acid ABC transporter integral membrane protein) (3e-07), NG0195 (spermidine/putrescine ABC transporter, permease protein) (3e-06), NG2012 (probable amino acid ABC transporter, permease protein, MSD protein in ABC transport system) (8e-05), NG0373 (amino acid ABC transporter, permease protein) (8e-05) and NG0968 (amino acid ABC transporter, permease protein, MSD protein in ABC transport system) (3e-04).


Pfam Summary:  Pfam Search
Residues 53 to 255 (E-value = 3.7e-14) place NG0216 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
35
transmembrane  
17  
33
transmembrane  
66  
82
transmembrane  
97  
113
transmembrane  
183  
199
transmembrane  
222  
238
transmembrane  
271  
287
transmembrane  
319  
335
transmembrane  
354  
370
transmembrane  
382  
398
non-globular  
395  
509
transmembrane  
431  
447
transmembrane  
487  
503

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKNTMSPKKIPIWLTGLILLIALPLTLPFLYVAMRSWQVGINRAVELLFR
PRMWDLLSNTLTMMAGVTLISIVLGIACALLFQRYRFFGKTFFQTAITLP
LCIPAFVSCFTWISLTFRVEGFWGTVMIMSLSSFPLAYLPVEAALKRISL
SYEEVSLSLGKSRLQTFFSAILPQLKPAIGSSVLLIALHMLVEFGAVSIL
NYPTFTTAIFQEYEMSYNNNTAALLSAVLTAVCGIVVFGESIFRGKAKIY
HSGKGVARPYPVKTLKLPGQIGAIVFLSSLLILGIIIPFGVLIHWMMVGT
SGTFALVSVFDAFIRSLSVSALGAILTILCALPLVWASVRYRNFLTVWID
RLPFLLHAVPGLVIALSLVYFSINYTPAVYQTFIVVILAYFMLYLPMAQT
TLRTSLEQLPKGMEQVGATLGRGHFFIFRTLVLPSILPGITAAFALVFLK
LMKELTATLLLTADDVHTLSTAVWEYTSDAQYAAATPYALMLVLFSGIPV
FLLKKYAFK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAACACTATGTCTCCTAAAAAAATACCCATTTGGCTTACCGGCCT
CATCCTACTGATCGCCCTGCCGCTTACCCTGCCTTTTTTATATGTCGCTA
TGCGTTCGTGGCAGGTCGGCATCAACCGCGCCGTCGAACTGTTGTTCCGC
CCGCGTATGTGGGATTTGCTCTCCAACACCTTGACGATGATGGCGGGCGT
TACCCTGATTTCCATTGTTTTGGGCATTGCCTGCGCCCTTTTGTTCCAAC
GTTACCGCTTCTTCGGCAAAACCTTTTTTCAGACGGCAATCACCCTGCCT
TTGTGCATCCCCGCATTTGTCAGCTGTTTCACCTGGATCAGCCTGACCTT
CCGCGTCGAAGGATTTTGGGGGACAGTGATGATTATGAGCCTGTCCTCGT
TTCCGCTCGCCTACCTGCCCGTCGAGGCGGCACTCAAACGCATCAGCCTG
TCTTACGAAGAAGTCAGCCTGTCCTTGGGCAAAAGCCGCCTGCAAACCTT
TTTTTCCGCCATCCTCCCACAGCTCAAACCCGCCATCGGCAGCAGCGTGT
TACTGATCGCCCTGCATATGCTGGTCGAATTTGGCGCGGTATCCATTTTG
AACTACCCCACTTTTACCACTGCCATTTTCCAAGAATACGAAATGTCCTA
CAACAACAATACCGCCGCCCTGCTTTCCGCTGTTTTGACGGCGGTGTGCG
GCATCGTCGTATTTGGAGAAAGCATATTTCGCGGCAAAGCCAAGATTTAC
CACAGCGGCAAAGGCGTTGCCCGTCCTTATCCCGTCAAAACCCTCAAACT
GCCCGGTCAGATCGGCGCGATTGTTTTTTTAAGCAGCTTGTTGATTTTGG
GCATTATTATCCCCTTTGGCGTATTGATACATTGGATGATGGTCGGCACT
TCCGGCACATTCGCGCTCGTATCCGTATTTGATGCCTTTATCCGTTCCTT
AAGCGTATCGGCTTTAGGTGCGATTTTGACTATATTATGTGCCTTGCCCC
TTGTTTGGGCATCGGTTCGCTATCGCAATTTTTTAACCGTTTGGATAGAC
AGGCTGCCGTTTTTACTGCACGCCGTCCCCGGTTTGGTTATCGCCCTATC
CTTGGTTTATTTCAGCATCAACTACACCCCTGCCGTTTACCAAACCTTTA
TCGTCGTCATCCTTGCCTATTTCATGCTTTACCTGCCGATGGCGCAAACC
ACCCTGAGGACTTCCTTGGAACAACTCCCCAAAGGGATGGAACAGGTCGG
CGCAACATTGGGGCGCGGACACTTCTTTATTTTCAGGACGTTGGTACTGC
CGTCCATCCTGCCCGGCATTACCGCCGCATTCGCACTCGTCTTCCTCAAG
CTGATGAAAGAGTTGACCGCCACCCTGCTGCTGACCGCCGACGATGTCCA
CACGCTCTCCACCGCCGTTTGGGAATACACATCGGACGCACAATACGCCG
CCGCCACCCCTTACGCGCTGATGCTGGTATTATTTTCCGGCATACCCGTA
TTCCTGCTGAAGAAATACGCCTTCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy