Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0173 IGR0177 IGR0172 IGR0174 IGR0178 IGR0180 IGR0171 IGR0175 IGR0176 IGR0179 NG0218 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0218 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216 NG0218 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 argH, - NG0219 pta, - NG0214 fbpB, - NG0216
* Calculated from Protein Sequence

Gene ID: NG0215

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fbpC  

Definition:
iron-uptake permease ATP-binding protein

Gene Start:
219127

Gene Stop:
218072

Gene Length:
1056

Molecular Weight*:
37889

pI*:
7.40

Net Charge*:
1.52

EC:
3.2.1.8  

Functional Class:
Transport and binding proteins; ABC Superfamily: ATP-binding protein  
Transport and binding proteins; Iron  

Pathway: pathway table

Primary Evidence:
Adhikari,P., Berish,S.A., Nowalk,A.J., Veraldi,K.L., Morse,S.A. and Mietzner,T.A. 1996.
The fbpABC locus of Neisseria gonorrhoeae functions in the periplasm-to-cytosol transport of iron.
J. Bacteriol. 178 (7): 2145-2149.
Medline: 96178986.

Berish,S.A., Mietzner,T.A., Mayer,L.W., Genco,C.A., Holloway,B.P. and Morse,S.A. 1990.
Molecular cloning and characterization of the structural gene for the major iron-regulated protein expressed by Neisseria gonorrhoeae.
J. Exp. Med. 171 (5): 1535-1546.
Medline: 90237747.



Secondary Evidence:
Adhikari,P., Kirby,S.D., Nowalk,A.J., Veraldi,K.L., Schryvers,A.B.
and Mietzner,T.A. 1995.
Biochemical characterization of a Haemophilus influenzae periplasmic iron transport operon.
J. Biol. Chem. 270 (42): 25142-25149.
Medline: 96027620.


Comment:
Oklahoma ID: NGO.215c

See ABC Transporters Analysis Section




Blast Summary:  PSI-Blast Search
NG0215 is similar to a previously sequenced N.gonorrhoeae protein in GenBank, 1588874, a fbpC gene: Residues 1-352 are 95% similar to residues 1-352 of NG0215.

NG0215 is orthologously related to CAB84123 Neisseria meningitidis, strain Z2491, a putative iron-uptake permease ATP-binding protein: residues 1-352 are 97% similar to residues 1-352 of NG0215.

Numerous significant hits in gapped BLAST; e.g. residues 5-347 are 54% similar to iron utilization protein C of Haemophilus influenzae (pir||T10888).Residues 5-347 are 54% similar to iron(III) ABC transporter, ATP-binding protein of Haemophilus influenzae Rd (gb|AAC21775.1|).Residues 3-289 are 45% similar to ABC transporter of Synechocystis sp (dbj|BAA18213.1|).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1130
COG name: ABC-type sugar transport system, ATPase component
Functional Class:  G
The phylogenetic pattern of COG1130 is -mtK--VCEBRh--GP-L---
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001140 (ABC transporter transmembrane region) with a combined E-value of 1.3e-39.
    IPB001140A    19-65
    IPB001140B    136-174
    IPB001140C    192-221


ProDom Summary:  Protein Domain Search
Residues 185-230 are 56% similar to a (ATP-BINDING PROTEIN TRANSPORT TRANSPORTER ABC MEMBRANE) protein domain (PD000174) which is seen in HITC_HAEIN.

Residues 233-347 are 87% similar to a (ATP-BINDING TRANSPORT IRONIII-TRANSPORT) protein domain (PD031650) which is seen in Q50966_NEIGO.

Residues 189-219 are identical to a (ATP-BINDING TRANSPORT PROTEIN ABC TRANSPORTER MEMBRANE) protein domain (PD000079) which is seen in Q50966_NEIGO.

Residues 91-221 are 28% similar to a (ATPASE PUTATIVE PROTEIN DPPD) protein domain (PD105293) which is seen in Q9ZAS3_STRPY.

Residues 76-105 are 80% similar to a (ATP-BINDING TRANSPORT PROTEIN ABC TRANSPORTER MEMBRANE) protein domain (PD000230) which is seen in HITC_HAEIN.

Residues 20-68 are identical to a (ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC) protein domain (PD000005) which is seen in Q50966_NEIGO.

Residues 138-179 are 71% similar to a (ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC) protein domain (PD000006) which is seen in Q50966_NEIGO.

Residues 69-137 are 82% similar to a (FBPC ATP-BINDING TRANSPORT) protein domain (PD055564) which is seen in Q50966_NEIGO.



Paralogs:  Local Blast Search


NG0215 is paralogously related to NG0192 (spermidine/putrescine ABC transporter, ATP-binding protein) (1e-50), NG0445 (sulfate ABC transporter, ATP-binding protein) (1e-50), NG2039 (spermidine/putrescine ABC transporter, ATP-binding protein) (4e-46), NG2013 (ABC transporter, ATP-binding protein, amino acid) (9e-39), NG0374 (amino acid ABC transporter, ATP-binding protein) (8e-38), NG0269 (amino acid ABC transporter, ATP-binding protein) (2e-35), NG2116 (ABC transporter, ATP-binding protein) (2e-32), NG2137 (ABC transporter, ATP-binding protein) (7e-31), NG1605 (probable ABC transporter ATP-binding protein) (4e-28), NG0770 (lipoprotein releasing factor (probable ABC-transporter, ATP-binding protein) (LolD)) (4e-27), NG2088 (ABC transporter, ATP-binding protein, iron related) (6e-26), NG1732 (probable ABC transporter, MSD-NBD fusion protein) (4e-25), NG1439 (ABC transporter, ATP-binding) (4e-25), NG1399 (ABC transporter, ATP-binding protein (NosF)) (7e-22), NG2165 (ABC transporter, ATP-binding) (4e-21), NG1434 (ABC transporter, ATP-binding protein) (5e-21), NG1922 (filamentation temperature sensitive cell division) (6e-21), NG0170 (ABC transporter, ATP-binding protein) (8e-21), NG1573 (ABC transporter, ATP-binding protein, NBD-NBD fusion protein) (1e-15), NG0870 (probable ABC-type transporter, ATP-binding protein (AbcZ)) (2e-14), NG0781 (ABC transporter, ATP-binding protein, NBD-NBD fusion protein) (1e-13), NG0764 (ABC-transporter, ATP-binding protein, NBD-NBD fusion protein) (5e-10), NG0126 (conserved hypothetical protein) (1e-07) and NG0840 (possible ABC transporter, ATP binding protein) (2e-05).


Pfam Summary:  Pfam Search
Residues 30 to 215 (E-value = 3.8e-66) place NG0215 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
102  
204
transmembrane  
233  
249

PDB Hit:
pdb|1G29|1G29-1 MALK 166.0 6e-42
pdb|1B0U|1B0U-A ATP-BINDING SUBUNIT OF THE HISTIDINE PERMEASE 108.0 1e-24
pdb|1F3O|1F3O-A CRYSTAL STRUCTURE OF MJ0796 ATP-BINDING CASSETTE 88.2 2e-18
pdb|1L2T|1L2T-A DIME

Gene Protein Sequence:
MTAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCL
AGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRN
IAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRVALA
RALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDRE
EALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALN
ADGTADCRLGRLPVQSGAPAGTRGTLLIRPEQFSLHPHSAPAASIHAVVL
KTTPKARHTEISLRAGQTVLTLNLPSAPTLSDGISAVLHLDGPALFFPGN
TL

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGCCGCCCTGCACATCGGACACCTGTCCAAAAGTTTTCAAAACAC
CCCGGTTTTAAACGACATTTCGCTCAGCCTCGACCCGGGCGAAATTCTCT
TTATCATCGGCGCGTCCGGCTGCGGCAAAACCACCCTTTTACGCTGCCTT
GCCGGTTTCGAACAACCCGATTCCGGCGAAATTTCGCTTTCCGGCAAAAC
CATCTTCTCGAAAAATACCAACCTTCCCGTCCGCGAACGCCGTTTGGGTT
ACCTCGTACAGGAAGGCGTGCTGTTCCCCCACCTGACCGTTTACCGCAAT
ATCGCCTACGGTCTCGGCAACGGCAAAGGCAGGACGGCGCAAGAGCGACA
GCGCATCGAAGCCATGTTGGAATTGACCGGCATTTCCGAACTTGCCGGAC
GCTATCCGCACGAACTTTCGGGCGGACAACAACAGCGCGTCGCCCTCGCC
CGCGCCCTCGCCCCCGACCCCGAACTGATTTTGTTGGACGAACCCTTCAG
CGCGCTGGACGAACAGTTGCGCCGCCAGATTCGCGAAGACATGATTGCCG
CCCTGCGCGCCAACGGCAAATCCGCCGTTTTTGTCAGCCACGACCGCGAA
GAAGCCCTGCAATACGCCGACCGGATTGCCGTGATGAAACAGGGGCGCAT
CCTCCAAACCGCAAGCCCTCACGAATTGTACCGACAACCTGCCGACCTTG
ATGCCGCCCTGTTTATCGGCGAAGGCATCGTGTTCCCCGCCGCGCTCAAC
GCCGACGGCACCGCCGATTGCAGATTGGGCCGCCTGCCCGTCCAAAGCGG
CGCACCCGCAGGCACGCGCGGTACACTGCTCATCCGTCCGGAACAGTTCA
GCCTTCACCCCCATTCCGCACCCGCCGCCTCCATTCACGCCGTGGTTCTC
AAAACCACGCCCAAAGCGCGGCATACCGAAATCAGCCTCAGGGCCGGACA
AACCGTCCTCACGCTCAACCTCCCTTCCGCCCCCACCCTGTCAGACGGCA
TTTCCGCCGTCCTCCATTTGGACGGTCCCGCCCTGTTCTTCCCCGGAAAT
ACCCTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy