Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0173 IGR0177 IGR0172 IGR0174 IGR0178 IGR0171 IGR0175 IGR0176 IGR0179 NG0218 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 NG0218 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209
* Calculated from Protein Sequence

Gene ID: NG0214

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pta  

Definition:
phosphate acyltransferase

Gene Start:
217884

Gene Stop:
216385

Gene Length:
1500

Molecular Weight*:
52087

pI*:
4.80

Net Charge*:
-11.48

EC:
2.3.1.8  

Functional Class:
Central intermediary metabolism; Pyruvate metabolism  

Pathway: pathway table
Pyruvate metabolism

Secondary Evidence:
Kakuda,H., Hosono,K., Shiroishi,K. and Ichihara,S.
Identification and characterization of the ackA (acetate kinase
A)-pta (phosphotransacetylase) operon and complementation analysis
of acetate utilization by an ackA-pta deletion mutant of
Escherichia coli
J. Biochem. 116 (4), 916-922 (1994)
MEDLINE: 95189796


Comment:
Oklahoma ID: NGO.214c

Blast Summary:  PSI-Blast Search
NG0214 is orthologously related to CAB84122 Neisseria meningitidis, strain Z2491, a putative phosphate acyltransferase protein: residues 1-500 are 97% similar to residues 1-500 of NG0214.

Numerous significant hits to phosphate acetyltransferase (phosphotransacetylase) proteins in gapped BLAST; e.g. residues 162-497 are 70% similar to gb|AAF94256.1| phosphate acetyltransferase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0280
COG name: Phosphotransacetylase
Functional Class:  C
The phylogenetic pattern of COG0280 is ------VcEBrH-jgpol--X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002505 (Phosphate acetyl/butaryl transferase) with a combined E-value of 1.9e-107.
    IPB002505A    294-328
    IPB002505B    337-359
    IPB002505C    369-378
    IPB002505D    402-445
    IPB002505E    462-494


ProDom Summary:  Protein Domain Search
Residues 177-492 are 69% similar to a (TRANSFERASE PHOSPHATE PHOSPHOTRANSACETYLASE) protein domain (PD002789) which is seen in PTA_HAEIN.



Paralogs:  Local Blast Search


NG0214 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 176 to 492 (E-value = 1.8e-172) place NG0214 in the PTA_PTB family which is described as Phosphate acetyl/butaryl transferase (PF01515)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19
cleavable N-terminal sequence  
1  
21
non-globular  
20  
175
transmembrane  
321  
337
transmembrane  
479  
495

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAKVLVVPVSAGLNTSAAAQAFAKALDAQVFQAVDATAETLLAQGKSDDW
FDALVGKVAALDAANLVIEGIAPDADKIYLAGKNVELALSLDAAAVFAVR
SDNTDADALAHQLNLAKQFFAAAPGVLEGFVVDGAAASVAEAAAEKTGLT
FFGSSDALKDVSVLAGREAKRLSPAQFRYNLIDFARQAGKRIVLPEGAEP
RTVQAAAICHEKGIARCVLLAKREEVEAVAKERGISLPDSLEIIDPASLV
EQYVEPMCELRKSKGLTPEDARKQLQDTVVLGTMMMAQNDVDGLVSGAVH
TTANTIRPALQLIKTAPGASLVSSVFFMLLPNQVLVFGDCAVNPNPTAQQ
LADIAIQSADSAKAFGIDPKVAMISYSTVNSGSGPDVDTVIEATKLAREK
RPDLAIDGPLQYDAATVPGVGKSKAPGSPVAGQATVLVFPDLNTGNCTYK
AVQRSANVLSVGPLLQGLRKPVNDLSRGALVEDIVFTIALTAVQAKQMEG


Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAAGTACTCGTCGTACCCGTATCTGCCGGACTGAACACCTCCGC
CGCCGCACAAGCCTTTGCAAAAGCACTGGACGCACAAGTTTTCCAAGCCG
TTGACGCAACCGCCGAAACCCTGCTCGCGCAAGGCAAAAGCGACGACTGG
TTCGACGCACTGGTCGGCAAAGTTGCCGCACTCGATGCCGCCAACCTCGT
CATCGAAGGCATCGCGCCCGATGCCGACAAAATCTATCTCGCAGGCAAAA
ACGTCGAACTGGCATTGTCCCTTGACGCGGCAGCCGTCTTCGCCGTCCGT
TCCGACAATACCGATGCCGACGCGCTGGCACACCAATTGAACCTTGCCAA
ACAGTTCTTCGCCGCCGCGCCGGGCGTATTGGAAGGTTTTGTCGTGGACG
GTGCGGCAGCCTCCGTTGCCGAAGCGGCAGCCGAGAAAACCGGCCTGACC
TTCTTCGGTTCGAGCGACGCGCTGAAAGACGTATCCGTATTGGCAGGCCG
CGAAGCAAAACGCCTGTCGCCGGCGCAATTCCGCTACAACCTGATCGACT
TCGCCCGCCAAGCCGGCAAACGCATCGTCCTGCCTGAAGGCGCAGAACCC
CGCACCGTCCAAGCCGCCGCCATCTGCCACGAAAAAGGCATTGCCCGCTG
CGTCCTGCTTGCCAAACGCGAAGAAGTCGAAGCCGTTGCCAAAGAACGCG
GCATCAGCCTGCCCGACTCTTTGGAAATCATCGATCCCGCCTCATTGGTC
GAACAATACGTCGAGCCGATGTGCGAACTGCGCAAATCCAAAGGCCTGAC
ACCCGAAGACGCGCGCAAGCAACTGCAAGACACCGTGGTACTCGGTACGA
TGATGATGGCGCAAAATGATGTGGACGGTTTGGTATCCGGTGCGGTTCAC
ACCACCGCCAACACCATCCGCCCCGCTTTGCAACTGATTAAAACCGCACC
GGGCGCAAGCCTCGTATCCAGCGTATTCTTTATGCTGCTACCAAATCAGG
TTCTGGTGTTCGGCGACTGCGCGGTTAATCCGAACCCGACCGCGCAACAG
CTTGCCGACATCGCCATCCAGTCTGCCGATTCCGCAAAAGCCTTCGGCAT
CGACCCGAAAGTGGCGATGATTTCCTACTCCACCGTCAACTCCGGCAGCG
GCCCCGATGTCGATACCGTCATCGAAGCCACCAAACTTGCCCGGGAAAAA
CGCCCCGACCTCGCCATCGACGGCCCGCTGCAATATGACGCGGCAACCGT
GCCGGGCGTAGGCAAATCCAAAGCCCCGGGCAGCCCGGTGGCAGGACAGG
CAACCGTTTTGGTCTTCCCCGACCTGAACACCGGCAACTGCACCTATAAA
GCCGTCCAACGCAGTGCCAACGTCTTGAGCGTCGGCCCGCTGCTGCAAGG
CCTGCGCAAACCGGTCAACGACCTGTCTCGCGGCGCGCTGGTGGAAGACA
TCGTGTTCACCATCGCCCTGACTGCCGTTCAGGCAAAACAAATGGAAGGC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy