Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0173 IGR0177 IGR0172 IGR0174 IGR0169 IGR0178 IGR0171 IGR0175 IGR0170 IGR0176 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpA, - NG0217 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 pglE,epsJ, - NG0207 NG0208
* Calculated from Protein Sequence

Gene ID: NG0213

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisH  

Definition:
probable imidazole-glycerol phosphate synthase amidotransferase component

Gene Start:
216252

Gene Stop:
215617

Gene Length:
636

Molecular Weight*:
23555

pI*:
8.20

Net Charge*:
3.49

EC:
2.4.2.-  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism

Comment:
Oklahoma ID: NGO.213c

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0185 (his2), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
NG0213 is orthologously related to D81929 Neisseria meningitidis, group A strain Z2491, a probable imidazole-glycerol phosphate synthase amidotransferase component protein: residues 1-212 are 97% similar to residues 1-212 of NG0213.

Numerous significant hits to amidotransferase proteins in gapped BLAST; e.g. residues 1-212 are 49% similar to gb|AAG08527.1|AE004927_5 glutamine amidotransferase of Pseudomonas aeruginosa, residues 5-210 are 42% similar to gb|AAG06540.1|AE004739_2 glutamine amidotransferase of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0118
COG name: Glutamine amidotransferase (HisH)
Functional Class:  E
The phylogenetic pattern of COG0118 is amt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000991 (Glutamine amidotransferase class-I) with a combined E-value of 2.6e-06.
    IPB000991A    80-89
    IPB000991B    188-198
    IPB000991B    156-166


ProDom Summary:  Protein Domain Search
Residues 79-210 are 48% similar to a (SYNTHASE GLUTAMINE BIOSYNTHESIS AMIDOTRANSFERASE) protein domain (PD000306) which is seen in HIS5_PSEAE.

Residues 1-63 are 39% similar to a (AMIDOTRANSFERASE GLUTAMINE TRANSFERASE) protein domain (PD107297) which is seen in O33565_RHOSH.



Paralogs:  Local Blast Search


NG0213 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 212 (E-value = 1.4e-34) place NG0213 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1KA9|1KA9-H IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE 118.0 1e-27
pdb|1JVN|1JVN-A CRYSTAL STRUCTURE OF IMIDAZOLE GLYCEROL 94.0 2e-20
pdb|1KXJ|1KXJ-A THE CRYSTAL STRUCTURE OF GLUTAMINE 80.0 4e-16
pdb|1GPW|1GPW-B STRU

Gene Protein Sequence:
MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTKIFLSGDPDRVSRADKVIF
PGQGAMPDCMAALTRGGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNT
DGLGWFGGKVRRFARDLRDPQGCRLKVPHMGWNTVRQTQNHPLFQGIPQN
TRFYFVHSYYFAPENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHD
AGLTMLKNFLNW

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACCGCCATTATCGATTACGGTATGGGCAACCTGCATTCCGTATT
GAAATCCGTCCGGACGGCGGGGCAGCTTGCCGGAAAAAATACCAAAATCT
TTTTAAGCGGCGACCCCGACCGCGTGTCCCGCGCCGACAAAGTCATTTTT
CCCGGGCAGGGCGCGATGCCCGACTGTATGGCGGCACTGACGCGCGGCGG
CTTGGACGAGGCAGTCAAAGACGCCTTAAAAAACAAACCGTTTTTCGGAA
TCTGCGTCGGTGCGCAACTTTTATTCGACCACAGCGAAGAAGGAAACACC
GACGGCTTGGGCTGGTTCGGCGGCAAAGTCAGACGCTTTGCCCGCGACCT
CCGCGACCCGCAGGGATGCCGTCTGAAAGTCCCGCATATGGGCTGGAACA
CCGTGCGCCAAACCCAAAACCACCCGCTTTTTCAAGGCATCCCCCAAAAC
ACGCGTTTTTATTTCGTCCACAGCTACTATTTCGCCCCCGAAAATCCCGA
AACCATATTGGGCGAAAGCGACTACCCGTCCCCGTTTGCCTGCATCGTCG
GCAAAGACAACGTATTCGCCACGCAATTTCACACCGAAAAAAGCCACGAT
GCCGGGCTGACGATGTTGAAAAACTTTTTAAACTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy