Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0173 IGR0177 IGR0172 IGR0174 IGR0169 IGR0171 IGR0175 IGR0170 IGR0176 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207 Type: tandem, Name:  - 14 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpC, - NG0215 pta, - NG0214 fbpB, - NG0216 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207
* Calculated from Protein Sequence

Gene ID: NG0212

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisA  

Definition:
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase

Gene Start:
215581

Gene Stop:
214847

Gene Length:
735

Molecular Weight*:
25850

pI*:
4.90

Net Charge*:
-7.94

EC:
5.3.1.16  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism

Comment:
Oklahoma ID: NGO.212c

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0185 (his2), NG0213 (hisH), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
NG0212 is orthologously related to AAF41054 Neisseria meningitidis, strain MC58, a phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase: residues 1-245 are 97% similar to residues 1-245 of NG0212.

Numerous significant hits to phosphoribosyl formimino-5-aminoimidazole proteins in gapped BLAST; e.g. residues 1-243 are 60% similar to gb|AAG08526.1|AE004927_4 phosphoribosylformimino-5-aminoimidazole carboxamide of Pseudomonas aeruginosa, residues 1-244 are 52% similar to sp|P26720|HIS4_AZOBR phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase of Azospirillum brasilense, residues 1-239 are 56% similar to emb|CAA60709.1| phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase of Rhodobacter sphaeroides.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0106
COG name: Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase
Functional Class:  E
The phylogenetic pattern of COG0106 is amt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000570 (Histidine biosynthesis protein) with a combined E-value of 6.7e-48.
    IPB000570A    2-16
    IPB000570B    30-55
    IPB000570C    77-87
    IPB000570D    98-108
    IPB000570E    161-202


ProDom Summary:  Protein Domain Search
Residues 1-237 are 56% similar to a (HISTIDINE BIOSYNTHESIS ISOMERASE PROTEIN) protein domain (PD000434) which is seen in HIS4_RHOSH.



Paralogs:  Local Blast Search


NG0212 is paralogously related to NG0211 (imidazoleglycerol phosphate synthase subunit) (8e-22).


Pfam Summary:  Pfam Search
Residues 1 to 241 (E-value = 2.9e-94) place NG0212 in the His_biosynth family which is described as Histidine biosynthesis protein (PF00977)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QO2|1QO2-A CRYSTAL STRUCTURE OF 107.0 2e-24
pdb|1H5Y|1H5Y-A HISF PROTEIN FROM PYROBACULUM AEROPHILUM 100.0 2e-22
pdb|1KA9|1KA9-F IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE 85.4 9e-18
pdb|1THF|1THF-D CYCL

Gene Protein Sequence:
MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPADTALHWFEQGARRLHLV
DLNGAFAGVPQNLPAIKDILAAVAKDIPVQLGGGMRDLKTIGQYLDLGLN
DVIIGTAAVKNPDLVREACKAFPGRIIVGLDAKDGMAAIDGWATVTGHHV
IDLAKRFEDDGVNSIIYTDIGRDGMMSGVNIDATVKLAQSVRIPVIASGG
LTGLDDIRALCAAEKHGVAGAITGRAIYEGSIDFAQAQQLADSLD

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGCTGATACCCGCCATCGATTTGAAAGAAGGACGTTGCGTCCGCTT
GAAACAAGGGCTGATGGAAGAGGCGACCGTCTTTTCCGATTCGCCCGCCG
ACACCGCGCTGCACTGGTTCGAACAAGGCGCGCGCCGCCTGCACCTGGTA
GATTTGAACGGCGCATTTGCCGGCGTTCCGCAAAACCTGCCCGCCATCAA
AGACATCCTCGCCGCCGTCGCCAAAGACATCCCCGTGCAGCTCGGCGGCG
GCATGCGCGATTTGAAAACCATCGGACAATATTTGGATTTGGGACTGAAC
GACGTGATTATCGGCACGGCGGCAGTCAAAAACCCCGACTTGGTGCGCGA
AGCGTGCAAAGCCTTCCCCGGCAGGATTATCGTCGGACTGGATGCCAAAG
ACGGTATGGCCGCCATCGACGGCTGGGCAACCGTAACCGGGCATCATGTA
ATTGATTTGGCAAAACGCTTTGAAGACGACGGTGTCAACAGCATCATCTA
CACCGACATCGGGCGCGACGGTATGATGAGCGGCGTGAACATCGACGCGA
CGGTCAAACTCGCCCAATCCGTCCGCATTCCCGTCATCGCCTCCGGCGGA
CTGACCGGCTTGGACGACATCCGCGCCCTGTGTGCCGCCGAAAAACATGG
CGTAGCAGGCGCGATTACCGGCCGCGCGATTTACGAGGGCAGCATCGATT
TTGCCCAAGCGCAGCAACTGGCAGATTCCCTCGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy