Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0173 IGR0172 IGR0174 IGR0169 IGR0168 IGR0171 IGR0175 IGR0170 IGR0176 IGR0167 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpC, - NG0215 pta, - NG0214 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207 potF, - NG0206 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpC, - NG0215 pta, - NG0214 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207 potF, - NG0206 Type: tandem, Name:  - 14 hisI,his2, - NG0210 hisH, - NG0213 hisA, - NG0212 hisF, - NG0211 fbpC, - NG0215 pta, - NG0214 prfC, - NG0209 NG0208 pglE,epsJ, - NG0207 potF, - NG0206
* Calculated from Protein Sequence

Gene ID: NG0210

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisI  his2  

Definition:
putative phosphoribosyl-AMP cyclohydrolase

Gene Start:
214033

Gene Stop:
213641

Gene Length:
393

Molecular Weight*:
14802

pI*:
6.50

Net Charge*:
-1.23

EC:
3.5.4.19  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism

Comment:
Oklahoma ID: NGO.210c

For other 'his' genes, see NG0185 (his2), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
NG0210 is orthologously related to CAB84118 Neisseria meningitidis, strain Z2491, a putative phosphoribosyl-AMP cyclohydrolase protein: residues 1-131 are 96% similar to residues 1-131 of NG0210.

Numerous significant hits in gapped BLAST; e.g. residues 3-127 are 60% similar to gb|AAG08451.1|AE004920_1 phosphoribosyl-AMP cyclohydrolase of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0139
COG name: Phosphoribosyl-AMP cyclohydrolase
Functional Class:  E
The phylogenetic pattern of COG0139 is amt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 31-106 are 67% similar to a (PHOSPHORIBOSYL-AMP HISTIDINE BIOSYNTHESIS CYCLOHYDROLASE) protein domain (PD002610) which is seen in HIS3_AZOCH.



Paralogs:  Local Blast Search


NG0210 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 31 to 106 (E-value = 2.3e-51) place NG0210 in the PRA-CH family which is described as Phosphoribosyl-AMP cyclohydrolase (PF01502)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MDKNLLEAVKFDEKGLVCAIAQDAETKRVLMVAWMNAEALQKTVETGFAH
YYSRSRQKQWMKGEESGHTQKVRELRLDCDGDTIVMLIAQNGGIACHTGR
ESCFYKKWNGGAWETADAVLKDEKEIYGSTH

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAAAACCTGCTTGAAGCCGTCAAATTTGACGAAAAAGGTTTGGT
TTGCGCCATCGCCCAAGATGCCGAAACCAAACGTGTTTTAATGGTGGCGT
GGATGAACGCCGAAGCCCTGCAAAAAACCGTCGAAACCGGCTTTGCCCAC
TATTACAGCCGTTCGCGCCAAAAACAATGGATGAAGGGCGAAGAGTCGGG
ACACACGCAAAAAGTCCGCGAACTGCGCCTCGACTGCGACGGCGATACCA
TTGTGATGCTCATCGCCCAAAACGGCGGCATCGCCTGCCACACCGGGCGC
GAAAGCTGCTTTTACAAAAAATGGAACGGCGGTGCGTGGGAAACCGCCGA
TGCCGTCCTGAAAGACGAAAAAGAGATTTACGGCAGCACGCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy