Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0169 IGR0165 IGR0168 IGR0164 IGR0162 IGR0167 IGR0163 IGR0166 NG0204 ppsA, - NG0200 NG0208 lolA, - NG0205 tpn, - NG0201 NG0202 pglE,epsJ, - NG0207 potF, - NG0206 NG0204 ppsA, - NG0200 NG0208 lolA, - NG0205 tpn, - NG0201 NG0202 pglE,epsJ, - NG0207 potF, - NG0206 Type: tandem, Name:  - 14 Type: inverse, Name:  - 179 NG0204 ppsA, - NG0200 gph, - NG0203 gph, - NG0203 NG0208 lolA, - NG0205 tpn, - NG0201 NG0202 pglE,epsJ, - NG0207 potF, - NG0206
* Calculated from Protein Sequence

Gene ID: NG0203

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gph  

Definition:
probable phosphoglycolate phosphatase

Gene Start:
206887

Gene Stop:
206180

Gene Length:
708

Molecular Weight*:
26071

pI*:
5.20

Net Charge*:
-8.21

EC:
3.1.3.18  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism

Comment:
Oklahoma ID: NGO.203c

Blast Summary:  PSI-Blast Search
NG0203 is orthologously related to A81178 Neisseria meningitidis, group B strain MD58, a phosphoglycolate phosphatase protein: residues 1-220 are 91% similar to residues 17-236 of NG0203. NG0203 is orthologously related to A81928 Neisseria meningitidis, group A strain Z2491, a probable phosphatase protein: residues 1-220 are 91% similar to residues 17-236 of NG0203.

Numerous significant hits in gapped BLAST; e.g. residues 18-233 are 36% similar to gb|AAG06560.1|AE004741_5 probable hydrolase of Pseudomonas aeruginosa, residues 19-224 are 37% similar to gb|AAF85268.1|AE004055_6 phosphoglycolate phosphatase of Xylella fastidiosa, residues 17-231 are 30% similar to gb|AAC26558.1| phosphoglycolate phosphatase (gph-2) of Treponema pallidum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0546
COG name: Predicted phosphatases
Functional Class:  R
The phylogenetic pattern of COG0546 is a-TkyQ-CEBRhuj--oL---
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** PR00413 (Haloacid dehalogenase/epoxide hydrolase family signature) with a combined E-value of 3.2e-06.
    PR00413A    18-29
    PR00413D    114-127


ProDom Summary:  Protein Domain Search
Residues 158-228 are 40% similar to a (PROTEIN PHOSPHATASE LONG PHOSPHOGLYCOLATE) protein domain (PD000816) which is seen in GPH_AQUAE.

Residues 102-231 are 25% similar to a (HYPOTHETICAL 14.3 KD PROTEIN) protein domain (PD081712) which is seen in YM33_MYCTU.



Paralogs:  Local Blast Search


NG0203 is paralogously related to NG1052 (phosphoglycolate phosphatase) (6e-18), NG0073 (phosphatase/hydrolase (possible phosphoglycolate phosphatase)) (7e-12) and NG2055 (uncharacterized hydrolase) (4e-04).


Pfam Summary:  Pfam Search
Residues 18 to 204 (E-value = 1.5e-32) place NG0203 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1FEZ|1FEZ-A THE CRYSTAL STRUCTURE OF BACILLUS CEREUS 39.5 6e-04

Gene Protein Sequence:
MPSETFRPALYKKGKHMIQAVLFDLDGTLADTALDLGGALNTQLARHGLP
EKSMDEIRTQASHGAAGLLKLGANITPEHPDYTAWRTEYLEEYDSRYAQD
TTLFDGVNELIAELDRRGIKWGIITNKPMRFTDKLVPKLGFAVPPATVVS
GDTCGEPKPSIKPMLHACGKIHADPQHTLYVGDAERDIQAGRNAGMKTVL
AEWGYISDEDDTGSWQADFHIRTPLDLLECLDKIQP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAACCTTTCGTCCCGCACTTTATAAAAAAGGAAAACACAT
GATACAAGCCGTATTGTTCGACCTCGACGGCACGCTCGCCGACACCGCCC
TAGACCTCGGCGGCGCACTCAACACCCAACTCGCCCGCCACGGACTGCCC
GAAAAAAGCATGGACGAAATCCGCACCCAAGCCAGCCACGGCGCGGCAGG
ATTGCTCAAACTCGGCGCGAACATCACGCCCGAACACCCCGACTATACCG
CATGGCGCACCGAATATCTGGAGGAATACGACAGCCGCTACGCCCAAGAC
ACCACTCTCTTCGACGGCGTGAACGAACTCATCGCCGAACTCGACAGACG
CGGCATCAAATGGGGCATCATCACCAACAAACCCATGCGCTTCACCGACA
AACTCGTTCCCAAACTCGGATTCGCCGTTCCGCCCGCCACCGTCGTCAGC
GGCGACACCTGCGGCGAACCCAAACCCAGCATCAAACCCATGCTGCACGC
CTGCGGAAAAATCCACGCCGACCCGCAACACACCCTCTACGTCGGCGACG
CGGAACGCGACATCCAAGCCGGACGCAACGCCGGTATGAAAACCGTCCTC
GCCGAATGGGGCTATATTTCCGATGAAGACGATACCGGCTCATGGCAGGC
GGATTTCCACATCCGCACGCCGCTCGATCTGCTCGAATGTCTGGACAAAA
TACAGCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy