Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0165 IGR0160 IGR0164 IGR0162 IGR0163 IGR0166 IGR0161 NG0204 rho, - NG0199 amtB, - NG0198 ppsA, - NG0200 tpn, - NG0201 NG0202 ordL, - NG0197 NG0204 rho, - NG0199 amtB, - NG0198 ppsA, - NG0200 tpn, - NG0201 NG0202 ordL, - NG0197 Type: inverse, Name:  - 179 NG0204 rho, - NG0199 amtB, - NG0198 ppsA, - NG0200 gph, - NG0203 gph, - NG0203 tpn, - NG0201 NG0202 ordL, - NG0197
* Calculated from Protein Sequence

Gene ID: NG0200

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ppsA  

Definition:
phosphoenolpyruvate synthase (pyruvate, water dikinase) (PEP synthase)

Gene Start:
204136

Gene Stop:
201755

Gene Length:
2382

Molecular Weight*:
87231

pI*:
4.90

Net Charge*:
-26.42

EC:
2.7.9.2  

Functional Class:
Central intermediary metabolism; Pyruvate metabolism  

Pathway: pathway table
Pyruvate metabolism
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Niersbach,M., Kreuzaler,F., Geerse,R.H., Postma,P.W. and Hirsch,H.J. 1992.
Cloning and nucleotide sequence of the Escherichia coli K-12 ppsA gene, encoding PEP synthase.
Mol. Gen. Genet. 231 (2): 332-336.
Medline: 92140374.

Comment:
Oklahoma ID: NGO.200c

Blast Summary:  PSI-Blast Search
NG0200 is similar to a previously sequenced N.gonorrhoeae protein (fragment) in GenBank, 1073192, a probable pyruvate, water dikinase protein: residues 1-87 are identical to residues 708-794 of NG0200.

NG0200 is orthologously related to CAB84108 Neisseria meningitidis, strain Z2491, a putative phosphoenolpyruvate synthase: residues 1-794 are 97% similar to residues 1-794 of NG0200.

Residues 6-794 are 66% similar to PPSA_ECOLI (2507167).

Numerous significant hits to phosphoenolpyruvate synthase (pyruvate, water dikinase) (PEP synthase) proteins in gapped BLAST; e.g. residues 5-789 are 68% similar to gb|AAG05159.1|AE004602_10 phosphoenolpyruvate synthase of Pseudomonas aeruginosa, residues 6-794 are 66% similar to gb|AAC74772.1| phosphoenolpyruvate synthase of Escherichia coli K12, residues 7-788 are 66% similar to gb|AAF96883.1| phosphoenolpyruvate synthase of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0574
COG name: Phosphoenolpyruvate synthase
Functional Class:  G
The phylogenetic pattern of COG0574 is aMTk-qvCeBR-uj---l--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002192 (Pyruvate phosphate dikinase, PEP/pyruvate binding domain) with a combined E-value of 2.3e-152.
    IPB002192A    21-30
    IPB002192B    158-172
    IPB002192C    201-237
    IPB002192D    313-323
    IPB002192E    411-437
    IPB002192F    457-466
    IPB002192G    486-517
    IPB002192H    575-588
    IPB002192I    601-610
    IPB002192J    629-654
    IPB002192K    683-717
    IPB002192L    746-763
***** IPB000121 (PEP-utilizing enzyme) with a combined E-value of 2.2e-74.
    IPB000121A    310-320
    IPB000121B    411-437
    IPB000121C    504-516
    IPB000121D    601-612
    IPB000121E    644-654
    IPB000121F    681-717
    IPB000121G    746-759


ProDom Summary:  Protein Domain Search
Residues 392-754 are 71% similar to a (PYRUVATE TRANSFERASE KINASE SYSTEM PHOSPHORYLATION) protein domain (PD000940) which is seen in PPSA_ECOLI.

Residues 6-391 are 60% similar to a (PYRUVATE DIKINASE ORTHOPHOSPHATE TRANSFERASE PHOSPHATE) protein domain (PD001289) which is seen in PPSA_ECOLI.

Residues 756-794 are 71% similar to a (PHOSPHOENOLPYRUVATE SYNTHASE PYRUVATE WATER DIKINASE PEP) protein domain (PD006548) which is seen in PPSA_ECOLI.



Paralogs:  Local Blast Search


NG0200 is paralogously related to NG2038 (phosphoenolpyruvate-protein phosphotransferase (PtsI)) (2e-23).


Pfam Summary:  Pfam Search
Residues 4 to 367 (E-value = 1.5e-141) place NG0200 in the PPDK_N family which is described as Pyruvate phosphate dikinase, PEP/pyruvate binding domain (PF01326)
Residues 368 to 461 (E-value = 5.9e-47) place NG0200 in the PEP-utilizers family which is described as PEP-utilising enzyme, mobile domain (PF00391)
Residues 464 to 793 (E-value = 4.5e-55) place NG0200 in the PEP-utilizers_C family which is described as PEP-utilising enzyme, TIM barrel domain (PF02896)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1JDE|1JDE-A K22A MUTANT OF PYRUVATE, PHOSPHATE DIKINASE 116.0 1e-26
pdb|1DIK|1DIK PYRUVATE PHOSPHATE DIKINASE 116.0 1e-26
pdb|1KC7|1KC7-A 116.0 1e-26
pdb|1GGO|1GGO-A T453A MUTANT OF PYRUVATE, PHOSPHATE DIKINASE 114.0

Gene Protein Sequence:
MADNYVIWFENLRMTDVERVGGKNASLGEMISQLTEKGVRVPGGFATTAD
AYRAFLAHNGLNERISAALAKLDVEDVSELARVGKEIRQWILDTPFPEQL
DAEIEAAWNKMITDADGADISVAVRSSATAEDLPDASFAGQQETFLNING
LDNVKKAMRHVFASLYNDRAISYRVHKGFEHDIVALSAGVQRMVRSDSGA
SGVMFTLDTESGYNQVVFVTSSYGLGENVVQGAVNPDEFYVFKPTLKAGK
PAILRKTMGSKHIKMIFTDKAEAGKSVTNVEVPEEDRNRFSITDEEITEL
AHYALTIEKHYGRPMDIEWGRDGLDGKLYILQARPETVKSQEEGSRNLRR
YAINGEKTVLCEGRAIGQKVGQGKVRLIKDASEMDSVEAGDVLVTDMTDP
DWEPVMKRASAIVTNRGGRTCHAAIIARELGIPAVVGCGNATELLENGQE
VTVSCAEGDTGFIYAGLLDVQITDVALDNMPKAPVKVMMNVGNPELAFSF
ANLPSEGIGLARMEFIINRQIGIHPKALLEFDKQDDELKAEIIRRIAGYA
SPVDFYVDKIAEGVATLAASVYPRKTIVRMSDFKSNEYANLVGGSVYEPH
EENPMLGFRGAARYVAESFKDCFALECKALKRVRDEMGLTNVEIMIPFVR
TLGEAEAVVKALKENGLERGKNGLRLIMMCELPSNAVLAEQFLQYFDGFS
IGSNDMTQLTLGLDRDSGLVSESFDERNPAVKVMLHLAISACRKQNKYVG
ICGQGPSDHPDFAKWLVGEGIESVSLNPDTVIETWLYLANELNK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCCGACAACTACGTAATCTGGTTTGAAAACCTGCGTATGACAGATGT
TGAACGCGTGGGCGGTAAAAACGCCTCGCTGGGCGAAATGATCAGTCAAC
TGACCGAAAAAGGCGTTCGCGTCCCCGGTGGCTTTGCCACCACAGCCGAT
GCCTACCGCGCATTTCTCGCACACAACGGTCTGAACGAACGCATTTCCGC
CGCTCTGGCAAAATTGGATGTCGAAGACGTTTCCGAACTGGCACGCGTCG
GCAAAGAAATCCGCCAATGGATTTTGGACACGCCCTTCCCCGAACAGCTC
GATGCCGAAATCGAAGCGGCATGGAACAAAATGATTACCGATGCCGACGG
CGCGGACATTTCCGTTGCCGTACGCTCTTCCGCAACCGCCGAAGACCTGC
CCGACGCATCATTTGCCGGCCAACAGGAAACCTTCCTGAATATCAATGGC
TTGGATAACGTTAAAAAAGCGATGCGCCACGTTTTCGCCTCCCTGTACAA
CGACCGCGCCATTTCCTACCGCGTCCACAAAGGCTTCGAACACGACATCG
TCGCCCTTTCCGCCGGCGTTCAACGCATGGTGCGTTCCGACAGCGGCGCA
TCAGGTGTGATGTTCACCCTCGACACCGAATCCGGCTACAACCAAGTCGT
CTTTGTTACCTCCTCTTACGGTCTGGGCGAAAACGTCGTACAAGGCGCGG
TCAACCCGGACGAATTTTATGTGTTCAAACCCACGCTCAAAGCAGGCAAA
CCCGCCATCCTGCGCAAGACCATGGGTTCGAAACACATCAAAATGATTTT
CACCGACAAAGCCGAAGCCGGCAAATCGGTAACCAACGTCGAAGTCCCCG
AAGAAGACCGCAACCGCTTCTCCATTACCGACGAAGAAATCACCGAGTTG
GCACACTACGCGCTGACCATCGAAAAACACTACGGCCGCCCGATGGATAT
CGAATGGGGACGCGACGGCCTGGACGGCAAACTCTACATCCTGCAAGCCC
GCCCCGAAACCGTCAAATCCCAAGAAGAAGGCAGCCGCAACCTGCGCCGC
TACGCCATCAACGGCGAAAAAACCGTCTTGTGCGAAGGTCGTGCCATCGG
TCAAAAAGTCGGTCAGGGCAAGGTGCGCCTGATTAAAGATGCTTCCGAGA
TGGATTCCGTCGAAGCCGGCGACGTACTGGTTACCGACATGACCGATCCG
GATTGGGAACCCGTGATGAAACGTGCTTCCGCCATCGTGACCAACCGCGG
CGGACGCACCTGCCACGCCGCCATCATCGCGCGCGAACTGGGTATTCCTG
CCGTCGTCGGCTGCGGCAATGCGACCGAACTCTTGGAAAACGGTCAGGAA
GTTACCGTATCCTGTGCCGAAGGCGATACCGGCTTTATCTATGCCGGCCT
GCTGGACGTACAAATTACCGATGTCGCCTTGGACAATATGCCAAAAGCAC
CCGTCAAAGTCATGATGAACGTCGGCAATCCCGAACTCGCATTCAGCTTC
GCCAATCTGCCCAGCGAAGGCATCGGCTTGGCGCGTATGGAATTTATCAT
CAACCGCCAAATCGGCATCCACCCGAAAGCCTTGTTGGAATTTGACAAAC
AAGACGACGAACTGAAAGCGGAAATTATCCGCCGCATCGCCGGTTACGCA
TCCCCTGTCGACTTCTACGTCGATAAAATCGCCGAAGGCGTGGCAACGCT
TGCCGCATCGGTTTATCCGCGTAAAACCATCGTCCGTATGTCCGACTTCA
AATCCAACGAATACGCCAACCTGGTCGGCGGCAGCGTATACGAACCGCAT
GAAGAAAACCCGATGTTGGGCTTCCGTGGTGCGGCGCGTTATGTTGCCGA
GAGCTTCAAAGACTGTTTCGCCTTGGAATGCAAAGCCTTGAAACGCGTTC
GTGACGAAATGGGTCTGACCAACGTCGAAATCATGATTCCGTTCGTCCGC
ACTTTGGGCGAAGCCGAAGCAGTGGTTAAGGCATTGAAAGAAAACGGCTT
GGAACGCGGCAAAAACGGCCTGCGCCTGATTATGATGTGCGAGCTGCCGA
GCAACGCGGTATTGGCGGAACAATTCCTGCAATACTTCGACGGCTTCTCC
ATCGGCTCGAACGACATGACCCAGCTGACCCTCGGCCTCGACCGAGACAG
CGGCTTGGTGTCCGAATCGTTTGACGAACGCAACCCTGCCGTCAAAGTGA
TGCTGCATCTTGCCATCTCCGCCTGCCGCAAGCAGAACAAATATGTCGGT
ATCTGCGGTCAAGGTCCGTCCGACCATCCGGACTTTGCCAAATGGCTGGT
TGGAGAAGGCATCGAAAGCGTGTCTCTGAACCCGGATACCGTCATCGAAA
CTTGGCTGTATTTGGCGAATGAATTGAACAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy