Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0154 IGR0147 IGR0145 IGR0144 IGR0146 IGR0148 IGR0149 IGR0152 IGR0150 IGR0151.1 IGR0153 IGR0151 tatA, - NG0183 his2, - NG0185 hitA, - NG0184 NG0186.1 maf, - NG0180 tatB, - NG0182 tatC, - NG0181 ald, - NG0186 hda, - NG0187 NG0178 NG0188 secF, - NG0190 secD, - NG0189 tatA, - NG0183 his2, - NG0185 hitA, - NG0184 NG0186.1 maf, - NG0180 tatB, - NG0182 tatC, - NG0181 ald, - NG0186 hda, - NG0187 NG0178 NG0188 secF, - NG0190 secD, - NG0189 Type: inverse, Name:  - 165 Type: inverse, Name:  - 182 his2, - NG0185 hitA, - NG0184 NG0186.1 maf, - NG0180 tatB, - NG0182 tatC, - NG0181 ald, - NG0186 hda, - NG0187 NG0178 NG0179 NG0179 tatA, - NG0183 NG0188 secF, - NG0190 secD, - NG0189
* Calculated from Protein Sequence

Gene ID: NG0186

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ald  

Definition:
zinc-binding alcohol dehydrogenase

Gene Start:
187391

Gene Stop:
186330

Gene Length:
1062

Molecular Weight*:
37920

pI*:
5.80

Net Charge*:
-9.18

EC:
1.1.1.1  1.1.1.4  

Functional Class:
Unassigned  

Pathway: pathway table
Bile acid biosynthesis
Butanoate metabolism
Fatty acid metabolism
Glycerolipid metabolism
Glycolysis / Gluconeogenesis
Tyrosine metabolism

Comment:
Oklahoma ID: NGO.186c

Blast Summary:  PSI-Blast Search
NG1086 is orthologous to AE002416, N. meningitidis MC58 alcohol dehydrogenase: residues 1-354 have 87% similarity to residues 1-354 in NG1086.

Residues 1-352 are 57% similar to the enzyme from L.lactis (12723828).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1065
COG name: Zn-dependent oxidoreductases
Functional Class:  R
The phylogenetic pattern of COG1065 is a---Y---EBR----p-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002328 (Zinc-containing alcohol dehydrogenase) with a combined E-value of 6.7e-25.
    IPB002328A    11-42
    IPB002328B    66-91
    IPB002328D    140-187
    IPB002328D    141-188
***** IPB002364 (Quinone oxidoreductase/zeta-crystallin) with a combined E-value of 5.4e-11.
    IPB002364    66-93


ProDom Summary:  Protein Domain Search
Residues 1-71 are 50% similar to a (ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE) protein domain (PD020101) which is seen in YAG1_YEAST.

Residues 274-354 are 37% similar to a (2,3-BUTANEDIOL DEHYDROGENASE EC 1.1.1.4) protein domain (PD085418) which is seen in Q59696_PSEPU.

Residues 3-71 are 63% similar to a (OXIDOREDUCTASE ZINC DEHYDROGENASE ALCOHOL NAD FAMILY) protein domain (PD000163) which is seen in O34788_BACSU.



Paralogs:  Local Blast Search


NG0186 is paralogously related to NG0711 (putative zinc-containing dehydrogenase) (1e-19), NG1442 (alcohol dehydrogenase) (5e-10) and NG0601.1 (formaldehyde dehydrogenase) (2e-05).


Pfam Summary:  Pfam Search
Residues 7 to 352 (E-value = 5.5e-76) place NG0186 in the ADH_zinc_N family which is described as Zinc-binding dehydrogenase (PF00107)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
133  
276
transmembrane  
176  
192

PDB Hit:
pdb|1E3J|1E3J-A KETOSE REDUCTASE (SORBITOL DEHYDROGENASE) FROM 136.0 8e-33
pdb|1JVB|1JVB-A ALCOHOL DEHYDROGENASE FROM THE ARCHAEON 63.6 5e-11
pdb|1HDZ|1HDZ-A ALCOHOL DEHYDROGENASE (E.C.1.1.1.1) (BETA-1 56.6 7e-09
pdb|1CDO|1CDO-A ALCO

Gene Protein Sequence:
MKAARFYNKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIF
IPPCGHPHPISGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYII
RDDVPTGEGSNYHLSKDMNFIGLGGCGGGLSEKIAVKRRWVHPISDKIPL
DQAALIEPLSVGHHAYVRSGAKAGDVALVGGAGPIGLLLAAVLKAKGIKV
IITELSKARKDKARESGVADYILDPSEVDVVEEVKKLTNGEGVDVAFECT
SVNKVLDTLVEACKPAANLVIVSIWSHPATVNVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDKLVSEGFERLIHNNESAVKIIV
NPNL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGCAGCACGTTTTTACAACAAAGGCGACATCCGCATCGAAGACAT
CCCCGAACCGACCGTCGCCCCCGGCACCGTCGGCATCAATGTCGCCTGGT
GCGGCATCTGCGGTACCGACCTGCACGAATTTATGGAAGGCCCGATTTTC
ATCCCGCCCTGCGGTCATCCGCATCCGATTTCCGGCGAGTCCGCGCCCGT
AACGATGGGACACGAGTTCTCCGGCGTGGTTTATGCCGTCGGCGAAGGCG
TGGACGACATTAAAGTCGGCCAACACGTCGTGGTCGAACCCTACATCATC
CGCGACGACGTACCGACCGGCGAAGGCAGCAACTACCACCTCTCCAAAGA
CATGAACTTTATCGGCTTGGGCGGCTGCGGCGGCGGCCTGTCCGAAAAAA
TCGCCGTCAAACGCCGTTGGGTGCATCCGATTTCCGACAAAATCCCGTTG
GATCAAGCTGCTTTGATTGAACCTCTGTCTGTCGGACACCACGCCTATGT
ACGCAGCGGCGCGAAAGCAGGCGATGTCGCATTGGTCGGCGGCGCAGGCC
CGATCGGTTTGCTGTTGGCCGCCGTGTTGAAAGCCAAAGGCATCAAAGTC
ATCATTACCGAGTTGAGTAAAGCACGCAAAGACAAAGCCCGCGAATCCGG
CGTTGCCGACTACATCCTCGACCCGTCCGAAGTCGATGTTGTTGAAGAAG
TGAAAAAACTGACCAACGGCGAAGGCGTGGACGTGGCGTTCGAATGTACC
AGCGTGAACAAAGTGTTGGATACTTTGGTCGAAGCCTGCAAACCCGCCGC
CAACTTGGTTATCGTATCCATCTGGAGCCACCCCGCCACCGTCAACGTCC
ACAGCGTCGTGATGAAAGAACTGGATGTGCGCGGCACGATTGCCTACTGC
AACGACCACGCGGAAACCATCAAACTGGTCGAAGAAGGCAAAATCAACCT
CGAACCCTTCATCACCCAGCGCATCAAGCTGGACAAACTGGTTTCCGAAG
GCTTCGAGCGTCTGATCCACAACAACGAATCCGCCGTTAAAATTATTGTG
AATCCAAACCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy