Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0147 IGR0145 IGR0144 IGR0146 IGR0148 IGR0149 IGR0152 IGR0150 IGR0151.1 IGR0153 IGR0151 tatA, - NG0183 hitA, - NG0184 his2, - NG0185 NG0186.1 maf, - NG0180 tatB, - NG0182 tatC, - NG0181 ald, - NG0186 hda, - NG0187 NG0178 NG0188 secD, - NG0189 tatA, - NG0183 hitA, - NG0184 his2, - NG0185 NG0186.1 maf, - NG0180 tatB, - NG0182 tatC, - NG0181 ald, - NG0186 hda, - NG0187 NG0178 NG0188 secD, - NG0189 Type: inverse, Name:  - 165 Type: inverse, Name:  - 182 hitA, - NG0184 his2, - NG0185 NG0186.1 maf, - NG0180 tatB, - NG0182 tatC, - NG0181 ald, - NG0186 hda, - NG0187 NG0178 NG0179 NG0179 tatA, - NG0183 NG0188 secD, - NG0189
* Calculated from Protein Sequence

Gene ID: NG0185

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
his2  

Definition:
phosphoribosyl-ATP cyclohydrolase

Gene Start:
186186

Gene Stop:
185866

Gene Length:
321

Molecular Weight*:
11909

pI*:
5.30

Net Charge*:
-4.80

EC:
3.6.1.31  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism

Comment:
Oklahoma ID: NGO.185c

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
NG0185 is orthologous to AL162754, N. meningitidis Z2491 putative phosphoribosyl-ATP cyclohydrolase: residues 1-107 have 96% similarity to residues 1-107 of NG0185.

Residues 6-107 are 50% similar to HIS2_AZOCH (3913841).


COGS Summary:  COGS Search
BeTs to 9 clades of COG0140
COG name: Phosphoribosyl-ATP pyrophosphohydrolase
Functional Class:  E
The phylogenetic pattern of COG0140 is -mt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-92 are 47% similar to a (PHOSPHORIBOSYL-ATP HISTIDINE BIOSYNTHESIS) protein domain (PD002611) which is seen in HIS2_AZOCH.



Paralogs:  Local Blast Search


NG0185 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 94 (E-value = 1.9e-37) place NG0185 in the PRA-PH family which is described as Phosphoribosyl-ATP pyrophosphohydrolase (PF01503)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MGDSVLSAIQQTIIQRKSADPSESYVAQLLHKGEDKILKKVIEEAGEVLM
ASKDKDPSHLVYEVADLWFHTMILLTHHDLKAEDVLDELSRRQGLSGLAE
KAARTES

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGAGATTCCGTACTATCCGCCATCCAACAAACCATTATACAGCGCAA
ATCTGCCGACCCGTCCGAATCTTACGTCGCACAGCTCCTGCACAAGGGCG
AGGACAAAATCCTAAAAAAAGTGATTGAAGAAGCGGGCGAAGTGTTGATG
GCATCCAAAGACAAAGACCCGTCCCACCTGGTTTACGAAGTTGCCGACTT
ATGGTTCCACACCATGATTCTTCTGACACACCACGACCTGAAGGCGGAAG
ACGTATTGGACGAACTTTCCCGCCGTCAGGGGCTGTCGGGGCTGGCCGAA
AAAGCCGCCCGTACAGAATCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy