Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0139 IGR0131 IGR0138 IGR0129 IGR0134 IGR0133 IGR0130 IGR0132 IGR0128 IGR0135 IGR0136 IGR0128.1 IGR0137 NG0160 rl19, - NG0171 NG0163 NG0162 NG0161 rimM, - NG0173 NG0165 trmD, - NG0172 troB, - NG0170 NG0169 NG0166 mntC, - NG0168 NG0167 tpn, - NG0159 ampN,pepN, - NG0158 NG0160 rl19, - NG0171 NG0163 NG0162 NG0161 rimM, - NG0173 NG0165 trmD, - NG0172 troB, - NG0170 NG0169 NG0166 mntC, - NG0168 NG0167 tpn, - NG0159 ampN,pepN, - NG0158 Type: tandem, Name:  - 12 rl19, - NG0171 NG0161 rimM, - NG0173 trmD, - NG0172 troB, - NG0170 NG0169 NG0166 mntC, - NG0168 NG0164 NG0165 NG0160 NG0162 NG0163 NG0164 NG0167 tpn, - NG0159 ampN,pepN, - NG0158
* Calculated from Protein Sequence

Gene ID: NG0166

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible periplasmic protein)

Gene Start:
170975

Gene Stop:
170112

Gene Length:
864

Molecular Weight*:
31417

pI*:
10.20

Net Charge*:
8.91

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

GetGenePrefixes: Unable to connect to the hhv1 database on localhost.
Unknown database 'hhv1'
GetGenePrefixes: Unable to connect to the prv1 database on localhost.
Unknown database 'prv1'
GetGenePrefixes: Unable to connect to the saga database on localhost.
Unknown database 'saga'
GetGenePrefixes: Unable to connect to the hhv8 database on localhost.
Unknown database 'hhv8'
GetGenePrefixes: Unable to connect to the hhv5 database on localhost.
Unknown database 'hhv5'
GetGenePrefixes: Unable to connect to the hhv2 database on localhost.
Unknown database 'hhv2'
Comment:
Oklahoma ID: NGO.166c

Blast Summary:  PSI-Blast Search
NG1066 is orthologous to AL162755, N. meningitidis Z2491 putative periplasmic protein: residues 1-289 have 88% similarity to residues 1-288 in NG0166.

Residues 1-285 are 25% similar to the HmcD protein of H.influnzae (2909664).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-285 are 25% similar to a (HMCD PROTEIN) protein domain (PD128552) which is seen in O53036_HAEIN.



Paralogs:  Local Blast Search


NG0166 is paralogously related to NG0432 (Neisseria-specific protein, uncharacterized (possible periplasmic protein)) (3e-79).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
53

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKNILLVFVSFVPLCVRTDLPLNIEDIMTDKGKWKLETSLTYLNSENSRA
ALASPVYIQTGSASFIPVPTEIQENGSNTDMLAGTLGLRYGLTGNTDIYG
SGSYLWHEERKLDGNGKTRNKRMSDISAGISHTFLKDGKNPALIAFLEST
VYEKSRNKASSGKSWLIGATTYKAIDPIVLSLTAAYRINGSKTLSDDVKY
KAGNYWMLNPNISFAANDRISLTGGIQWLGKQPDRIDGKKESARNTSTYA
HFGAGFGFTKTAALNASARFNVSGQSSSELKLGVQHTF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAATATTCTCTTAGTATTTGTTAGCTTTGTGCCATTATGTGTCCG
CACTGATCTGCCGCTGAATATCGAAGACATAATGACCGACAAGGGAAAAT
GGAAACTGGAAACTTCCCTTACCTACCTGAACAGCGAAAACAGCCGCGCC
GCACTTGCCTCACCGGTTTACATTCAGACCGGCTCCGCTTCCTTTATCCC
CGTCCCGACCGAAATTCAGGAAAACGGCAGCAATACCGATATGCTCGCCG
GCACGCTCGGTTTGCGCTACGGACTGACCGGCAATACCGACATTTACGGC
AGCGGCAGCTATCTGTGGCACGAAGAACGCAAACTCGACGGCAACGGCAA
AACCCGCAACAAACGGATGTCCGACATATCCGCCGGCATCAGCCACACCT
TCCTTAAAGACGGCAAAAATCCCGCACTCATCGCTTTCCTCGAAAGCACG
GTTTACGAAAAATCGCGCAACAAAGCCTCGTCGGGAAAATCGTGGCTCAT
CGGCGCCACCACCTACAAAGCCATAGATCCGATTGTCCTTTCCCTCACCG
CCGCCTACCGCATCAACGGCAGCAAAACCCTTTCAGACGACGTCAAATAC
AAAGCAGGCAATTACTGGATGCTGAATCCCAACATCTCATTTGCCGCCAA
CGACAGAATCAGCCTGACCGGAGGCATCCAATGGCTGGGCAAACAGCCCG
ACCGCATAGACGGCAAAAAAGAATCCGCAAGAAACACATCCACCTACGCC
CATTTCGGCGCAGGTTTCGGTTTCACCAAAACCGCGGCTTTAAACGCATC
CGCACGTTTCAACGTTTCAGGGCAAAGCAGTTCCGAACTGAAATTGGGCG
TACAGCATACATTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy