Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0131 IGR0134 IGR0129 IGR0133 IGR0130 IGR0132 IGR0128 IGR0135 IGR0136 IGR0128.1 IGR0127 NG0160 NG0163 NG0162 NG0161 NG0165 troB, - NG0170 NG0169 NG0166 mntC, - NG0168 NG0167 tpn, - NG0159 NG0156 ampN,pepN, - NG0158 NG0160 NG0163 NG0162 NG0161 NG0165 troB, - NG0170 NG0169 NG0166 mntC, - NG0168 NG0167 tpn, - NG0159 NG0156 ampN,pepN, - NG0158 Type: tandem, Name:  - 12 NG0161 troB, - NG0170 NG0169 NG0166 mntC, - NG0168 NG0164 NG0165 NG0160 NG0162 NG0163 NG0164 NG0167 tpn, - NG0159 NG0156 ampN,pepN, - NG0158
* Calculated from Protein Sequence

Gene ID: NG0162

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Neisseria-specific protein, uncharacterized

Gene Start:
168742

Gene Stop:
168365

Gene Length:
378

Molecular Weight*:
14742

pI*:
10.20

Net Charge*:
5.15

EC:
 

Functional Class:
Neisseria-specific protein  
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.162c

Blast Summary:  PSI-Blast Search
NG0162 is orthologous to AE002438, N. meningitidis MC58 hypothetical protein: residues 1-66 have 96% similarity to 1-66 in NG0162.
NG0162 is orthologous to AL162755, N. meningitidis Z2491 hypothetical protein NMA1070: residues 1-66 have 95% similarity to 1-66 in NG0162.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0162 is paralogously related to NG0160 (Neisseria-specific protein, uncharacterized) (9e-09).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MQLICADWTGIGNFMKTFEKTWSAQYRDMEISVRNFWNLKRTGAEVYING
RRVYHNEAGMASASLRSLMGEYLEFEESGTKITVEIGSAWHFNETIRNIN
THLRGTKLPGSNWRVQDKGHFHLWKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTGATATGTGCCGATTGGACAGGTATAGGAAATTTTATGAAAAC
CTTCGAAAAAACATGGTCTGCACAATATCGGGATATGGAAATTTCAGTAC
GGAATTTTTGGAATTTGAAACGGACAGGGGCGGAAGTCTATATCAACGGC
AGGCGGGTTTATCATAACGAAGCCGGGATGGCGTCTGCTTCTTTGCGTTC
GCTAATGGGGGAATACCTGGAATTTGAAGAAAGCGGTACGAAAATTACCG
TTGAAATCGGCAGCGCGTGGCATTTTAATGAAACTATAAGAAATATTAAT
ACACATTTAAGAGGTACGAAACTTCCAGGTTCTAACTGGAGAGTTCAAGA
TAAGGGGCATTTTCATCTTTGGAAAAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy