Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0131 IGR0134 IGR0129 IGR0133 IGR0130 IGR0132 IGR0128 IGR0135 IGR0126 IGR0128.1 IGR0127 IGR0125 NG0160 NG0163 NG0162 NG0161 NG0165 NG0169 NG0166 mntC, - NG0168 NG0155 NG0167 tpn, - NG0159 NG0156 ampN,pepN, - NG0158 NG0160 NG0163 NG0162 NG0161 NG0165 NG0169 NG0166 mntC, - NG0168 NG0155 NG0167 tpn, - NG0159 NG0156 ampN,pepN, - NG0158 Type: tandem, Name:  - 12 NG0161 NG0169 NG0166 mntC, - NG0168 NG0164 NG0165 NG0160 NG0162 NG0163 NG0164 NG0167 tpn, - NG0159 NG0156 ampN,pepN, - NG0158 NG0155
* Calculated from Protein Sequence

Gene ID: NG0160

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Neisseria-specific protein, uncharacterized

Gene Start:
167805

Gene Stop:
167617

Gene Length:
189

Molecular Weight*:
6961

pI*:
8.40

Net Charge*:
1.18

EC:
 

Functional Class:
Neisseria-specific protein  
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.160c

Blast Summary:  PSI-Blast Search
NG0160 is orthologous to AL162755,N. meningitidis Z2491 hypothetical protein NMA1067: residues 1-63 have 95% similarity to residues 1-63 in NG0160.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0160 is paralogously related to NG0162 (Neisseria-specific protein, uncharacterized) (3e-09).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LLPTRSVSSLLLGEYLEFEENGTKITAEIGSAWHFLGAACRISINGKYYA
GNRIVWFAKKAES

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTGCCCACGCGTTCTGTTTCAAGTTTATTATTGGGTGAATATTTGGA
ATTTGAAGAAAACGGTACAAAGATTACTGCGGAAATCGGCAGTGCATGGC
ATTTTTTGGGCGCGGCTTGTCGGATTTCAATAAATGGAAAGTATTATGCG
GGTAATCGGATTGTTTGGTTTGCCAAAAAAGCCGAAAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy