Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0131 IGR0129 IGR0124 IGR0133 IGR0130 IGR0132 IGR0128 IGR0126 IGR0128.1 IGR0127 IGR0125 NG0160 NG0163 NG0162 NG0161 NG0165 NG0166 NG0155 fis, - NG0152 ruvC, - NG0153 tpn, - NG0159 NG0156 msbB, - NG0154 ampN,pepN, - NG0158 NG0160 NG0163 NG0162 NG0161 NG0165 NG0166 NG0155 fis, - NG0152 ruvC, - NG0153 tpn, - NG0159 NG0156 msbB, - NG0154 ampN,pepN, - NG0158 NG0161 NG0166 NG0164 NG0160 NG0162 NG0165 NG0163 NG0164 fis, - NG0152 ruvC, - NG0153 tpn, - NG0159 NG0156 msbB, - NG0154 ampN,pepN, - NG0158 NG0155
* Calculated from Protein Sequence

Gene ID: NG0158

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ampN  pepN  

Definition:
aminopeptidase N

Gene Start:
164163

Gene Stop:
166763

Gene Length:
2601

Molecular Weight*:
97512

pI*:
5.10

Net Charge*:
-25.17

EC:
3.4.11.2  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Glutathione metabolism

Secondary Evidence:
Foglino,M., Gharbi,S. and Lazdunski,A.
Nucleotide sequence of the pepN gene encoding aminopeptidase N of
Escherichia coli
Gene 49 (3), 303-309 (1986)
M:87192020

McCaman,M.T. and Gabe,J.D.
The nucleotide sequence of the pepN gene and its over-expression in Escherichia coli
Gene 48 (1), 145-153 (1986)
M:87163509

Chandu D, Kumar A, Nandi D.
PepN, the Major Suc-LLVY-AMC-hydrolyzing Enzyme in Escherichia coli, Displays Functional Similarity with Downstream
Processing Enzymes in Archaea and Eukarya. IMPLICATIONS IN CYTOSOLIC PROTEIN DEGRADATION.
J Biol Chem. 2003 Feb 21;278(8):5548-56.
PMID: 12482750


Comment:
Oklahoma ID: NGO.158

For other 'pep' genes, see NG1227 (pepA, ampA), NG1456 (pepP), NG2020 (pepC).

Blast Summary:  PSI-Blast Search
NG0158 is orthologous to AE002490, N. meningitidis (MC58) aminopeptidase N: residues 1-866 have 94% similarity to residues 1-866 in NG0158.
Residues 5-884 in NG0158 have 47% similarity to residues 8-866 in AE004732, P. aeruginosa aminopeptidase N.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0308
COG name: Aminopeptidase N
Functional Class:  E
The phylogenetic pattern of COG0308 is ----Y--ce-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00756 (Membrane alanyl dipeptidase (M1) family signature) with a combined E-value of 5.1e-26.
    PR00756A    122-137
    PR00756B    172-187
    PR00756C    254-264
    PR00756D    290-305
    PR00756E    309-321


ProDom Summary:  Protein Domain Search
Residues 455-866 are 34% similar to a (AMINOPEPTIDASE N ALPHA-AMINOACYLPEPTIDE HYDROLASE) protein domain (PD043117) which is seen in AMPN_ECOLI.

Residues 14-444 are 61% similar to a (AMINOPEPTIDASE HYDROLASE METALLOPROTEASE ZINC N PROTEIN) protein domain (PD001134) which is seen in AMPN_ECOLI.



Paralogs:  Local Blast Search


NG0158 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 380 (E-value = 6.8e-58) place NG0158 in the Peptidase_M1 family which is described as Peptidase family M1 (PF01433)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
570  
620

PDB Hit:
pdb|1HS6|1HS6-A STRUCTURE OF LEUKOTRIENE A4 HYDROLASE COMPLEXED 76.1 2e-14
pdb|1H19|1H19-A STRUCTURE OF [E271Q] LEUKOTRIENE A4 HYDROLASE 74.9 5e-14
pdb|1HS6|1HS6-A STRUCTURE OF LEUKOTRIENE A4 HYDROLASE COMPLEXED 77.3 1e-14
pdb|1H19|1H19-A STRU

Gene Protein Sequence:
MSKTVRYLKDYQTPAYRILETELHFDIAEPQTVVKSRLTVEPQRAGEPLV
LDGSAKLLSVKINGAAADYVLEGETLTIADVPSERFTVEVETEILPAENK
SLMGLYASGGNLFTQCEPEGFRKITFYIDRPDVMSKFTTTIVADKKRYPV
LLSNGNKIDGGEFSDGRHWVKWEDPFAKPSYLFALVAGDLAVTEDRFTTM
SGRNVKIEFYTTEADKPKVGFAVESLKNAMKWDETRFGLEYDLDIFMVVA
VGDFNMGAMENKGLNIFNTKFVLADSRTATDTDFEGIESVVGHEYFHNWT
GNRVTCRDWFQLSLKEGLTVFRDQEFSGDRAGRAVRRIENIRLLRQNQFP
EDAGPTAHPVRPVSYEEMNNFYTMTVYEKGAEVVRMYHTLLGEEGFQKGM
KLYFQRHDGQAVTCDDFRAAMADANGINLDQFALWYSQAGTPVLEAEGRL
KNNVFELTIKQTVPPTPDMADKQPMMIPVKVGLLNRNGEAVAFDYQGKRA
TEAVLLMTEAEQAFPLEGVTEAVVPSLLRGFSAPVYLNYPYSDDDLLLLL
AHDSDAFTCWEAAQTLYRRAVAANLAALSDGIGLPKHEKLLAAVEKVISD
DLLDNAFKALLLGVPSEAELWDGTENIDPLRYHQAREALLDTLAVRFLPK
WHELDRQAAKQENQSYEYSPETADWRTLRNVCRAFVLRADPAHIETVAEK
YGEMAQNMTHEWGILSAVNGNESDTRNCLLAQFADKFSDDALVMDKYFAL
IGSSRRSDTLQQVQTALQHPKFSLENPNKARSLIGSFSRNVPHFHAQDGS
GYRFIADKVIEIDRFNPQVAARLVQAFNLCNKLEPHRKNLVKQELQCIRA
QEGLSKDVGEIVGKILG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAAACCGTCCGTTATCTGAAAGATTACCAAACGCCTGCCTACCG
CATTCTTGAAACCGAACTGCATTTCGACATTGCCGAACCGCAAACCGTCG
TGAAGTCGCGTTTGACGGTCGAGCCGCAGAGGGCGGGCGAGCCGCTGGTG
TTGGACGGTTCGGCAAAACTCTTGTCCGTCAAAATCAACGGCGCGGCGGC
GGATTATGTGTTGGAAGGCGAGACGCTGACGATTGCAGACGTACCGTCCG
AACGCTTCACCGTCGAAGTGGAAACCGAAATCCTGCCGGCGGAAAACAAA
TCGCTGATGGGGCTGTATGCTTCCGGCGGCAATCTGTTTACCCAGTGCGA
GCCGGAGGGCTTCCGCAAAATCACGTTCTACATCGACCGTCCGGATGTGA
TGTCCAAGTTCACGACCACCATCGTCGCGGACAAAAAACGCTATCCCGTT
TTGCTTTCCAACGGCAACAAAATCGACGGCGGCGAGTTTTCAGACGGCCG
CCATTGGGTGAAATGGGAAGACCCGTTTGCCAAACCGAGTTATCTGTTTG
CTTTGGTCGCGGGCGATTTGGCGGTAACGGAAGACCGTTTCACCACCATG
AGCGGCAGAAACGTCAAAATCGAGTTTTACACCACCGAAGCGGACAAACC
CAAGGTCGGCTTTGCCGTGGAATCGTTGAAAAACGCGATGAAGTGGGACG
AAACGCGCTTCGGGTTGGAATATGACTTGGATATTTTCATGGTCGTCGCC
GTAGGCGATTTCAATATGGGCGCGATGGAAAACAAGGGTTTGAACATTTT
TAACACCAAGTTCGTCCTCGCCGACAGCCGCACCGCCACCGATACCGATT
TCGAAGGCATTGAATCCGTGGTCGGACACGAATATTTCCACAACTGGACG
GGCAACCGCGTAACCTGCCGCGACTGGTTCCAGCTTTCGCTGAAGGAAGG
GCTGACCGTGTTCCGCGACCAAGAGTTTTCCGGCGACCGCGCCGGCCGCG
CCGTGCGCCGCATCGAGAACATCCGCCTGCTGCGCCAGAACCAGTTCCCC
GAAGACGCAGGCCCGACCGCCCATCCGGTGCGCCCCGTCAGCTATGAGGA
GATGAACAATTTCTACACCATGACCGTTTATGAAAAAGGCGCGGAAGTGG
TGCGGATGTATCATACCCTGCTCGGCGAAGAGGGCTTCCAAAAAGGCATG
AAGCTATATTTCCAACGCCACGACGGACAGGCAGTGACCTGCGACGATTT
CCGCGCGGCGATGGCGGATGCGAACGGCATCAATCTCGACCAGTTCGCCT
TGTGGTACAGCCAGGCGGGCACGCCCGTTTTGGAAGCCGAAGGCCGTCTG
AAAAACAATGTTTTCGAGTTAACCATTAAACAAACCGTGCCGCCCACGCC
CGATATGGCGGACAAACAGCCGATGATGATTCCCGTCAAAGTCGGGCTTC
TGAACCGCAACGGCGAAGCGGTGGCATTCGATTATCAGGGCAAACGCGCA
ACCGAAGCCGTGTTGCTGATGACCGAAGCCGAACAGGCCTTCCCGCTCGA
AGGTGTAACCGAAGCCGTCGTTCCCTCGCTGCTGCGCGGGTTCAGCGCGC
CAGTGTATCTGAACTATCCGTACAGCGACGACGACCTGCTGCTCCTGCTC
GCCCACGACAGCGACGCTTTCACGTGCTGGGAAGCCGCCCAAACGCTCTA
CCGTCGCGCCGTCGCCGCCAACCTTGCCGCGCTTTCAGACGGCATCGGGT
TGCCGAAACACGAAAAACTGCTTGCCGCCGTCGAAAAAGTCATTTCAGAC
GACCTCTTGGACAACGCCTTCAAAGCCCTGCTTTTGGGCGTGCCGTCCGA
AGCCGAACTGTGGGACGGCACGGAAAACATCGACCCGCTGCGCTACCATC
AGGCGCGCGAAGCCTTGTTGGATACGCTTGCCGTCCGCTTCCTGCCGAAA
TGGCACGAATTGGACCGTCAGGCGGCGAAGCAGGAAAACCAAAGTTACGA
ATACAGCCCCGAAACCGCCGACTGGCGCACGCTGCGCAACGTCTGCCGCG
CCTTCGTCCTGCGCGCCGACCCCGCGCACATCGAAACTGTTGCCGAAAAA
TACGGCGAAATGGCGCAAAACATGACCCACGAATGGGGCATCCTGTCCGC
CGTCAACGGCAACGAAAGCGATACGCGCAACTGCCTGCTGGCGCAGTTTG
CCGACAAGTTTTCAGACGACGCGCTGGTGATGGACAAATATTTCGCCCTT
ATCGGCTCAAGCCGCCGCAGCGACACCCTGCAACAGGTTCAAACCGCCTT
GCAGCATCCGAAATTCAGTCTCGAAAACCCCAACAAAGCCCGTTCGCTCA
TCGGCAGCTTCAGCCGCAACGTCCCGCATTTTCACGCACAAGACGGCAGC
GGCTACCGCTTCATCGCCGACAAAGTCATCGAAATCGACCGCTTCAACCC
GCAGGTCGCCGCCCGCCTGGTGCAGGCGTTCAACCTCTGCAACAAGCTCG
AGCCGCACCGCAAAAACTTGGTGAAACAAGAATTGCAGTGCATTCGGGCG
CAGGAAGGATTGTCGAAAGACGTGGGCGAAATCGTCGGCAAGATTTTGGG
T


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy